StarFunc result for job id Q7Z6L1

User Input

>input (1165 residues)
MPNSVLWAVDLFGRVYTLSTAGQYWEMCKDSQLEFKRVSATTQCCWGIACDNQVYVYVCA
SDVPIRRREEAYENQRWNPMGGFCEKLLLSDRWGWSDVSGLQHRPLDRVALPSPHWEWES
DWYVDENFGGEPTEKGGWTYAIDFPATYTKDKKWNSCVRRRKWIRYRRYKSRDIWAKIPS
KDDPKELPDPFNDLSVGGWEITEEPVGRLSVWAVSLQGKVWYREDVSHSNPEGSSWSLLD
TPGEVVQISCGPHDLLWATLWEGQALVREGINRSNPKGSSWSIVEPPGSENGVMHISVGV
SVVWAVTKDWKVWFRRGVNSHNPCGTSWIEMVGEMTMVNVGMNDQVWGIGCEDRAVYFRQ
GVTPSELSGKTWKAIIAARECDRSHSGSSSSLLSAGCFFGDEVRGSGESAPSDTDASSEV
ERPGPGQILPAEPLDDSKNATGNSASGLGAGRTAEDTVEDACPAEGSREARPNTHPGPAP
TPAELPWTNIDLKEAKKVPSHSAAGFPETTSLSSLGLLPLGLEEPYGVDDHPLWAWVSGG
GCVVEACAMPRWFTVQAGLSSSVHMLSLSITPAQTAAWRKQIFQQLTERTKRELENFRHY
EQAVEQSVWVKTGALQWWCDWKPHKWVDVRLALEQFTGHDGVRDSILFIYYVVHEEKKYI
HIFLNEVVALVPVLNETKHSFALYTPERTRQRWPVRLAAATEQDMNDWLALLSLSCCESR
KVQGRPSPQAIWSITCKGDIFVSEPSPDLEAHEHPLPCDQMFWRQMGGHLRMVEANSRGV
VWGIGYDHTAWVYTGGYGGGCFQGLASSTSNIYTQSDVKCVHIYENQRWNPVTGYTSRGL
PTDRYMWSDASGLQECTKAGTKPPSLQWAWVSDWFVDFSVPGGTDQEGWQYASDFPASYH
GSKTMKDFVRRRCWARKCKLVTSGPWLEVPPIALRDVSIIPESPGAEGSGHSIALWAVSD
KGDVLCRLGVSELNPAGSSWLHVGTDQPFASISIGACYQVWAVARDGSAFYRGSVYPSQP
AGDCWYHIPSPPRQRLKQVSAGQTSVYALDENGNLWYRQGITPSYPQGSSWEHVSNNVCR
VSVGPLDQVWVIANKVQGSHSLSRGTVCHRTGVQPHEPKGHGWDYGIGGGWDHISVRANA
TRAPRSSSQEQEPSAPPEAHGPVCC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z6L1	1.000	1.000	0.000	1165	1.000	1.000	Q7Z6L1.pdb.gz	TCPR1_HUMAN Tectonin beta-propeller repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=TECPR1 PE=1 SV=1
2	PDB:7dvq3	0.132	0.129	3.759E-7	1193	0.069	0.067	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
3	PDB:6urgA	0.127	0.124	3.954E-7	1202	0.087	0.084	6urgA.pdb.gz	Structural Insights into the Human Pre-mRNA 3'-End Processing Machinery.
4	PDB:6lqsBE	0.136	0.184	4.840E-7	823	0.061	0.086	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
5	PDB:5xgsA	0.132	0.339	6.232E-7	398	0.031	0.090	5xgsA.pdb.gz
6	PDB:6r8yK	0.134	0.176	1.548E-6	825	0.065	0.092	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.
7	PDB:6xk9Y	0.120	0.124	1.629E-6	1106	0.083	0.088	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.
8	PDB:7uknA	0.124	0.135	1.993E-6	1059	0.066	0.073	7uknA.pdb.gz	Insight into Viral Hijacking of CRL4 Ubiquitin Ligase through Structural Analysis of the pUL145-DDB1 Complex.
9	PDB:5o9zw	0.124	0.126	2.440E-6	1140	0.069	0.070	5o9zw.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
10	PDB:7d5sBE	0.136	0.177	2.567E-6	865	0.059	0.080	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
11	PDB:5tbkI	0.152	0.368	2.840E-6	419	0.033	0.091	5tbkI.pdb.gz
12	AFDB:F1QM29	0.116	0.100	9.925E-5	1413	0.072	0.059	F1QM29.pdb.gz	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
13	AFDB:Q95RJ9	0.116	0.178	1.645E-4	700	0.063	0.104	Q95RJ9.pdb.gz	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
14	AFDB:Q54J96	0.124	0.101	3.694E-4	1476	0.052	0.041	Q54J96.pdb.gz	Q54J96_DICDI Enhancer of mRNA-decapping protein 4 WD40 repeat region domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288241 PE=4 SV=1
15	AFDB:Q6PDH4	0.084	0.182	7.886E-4	491	0.034	0.081	Q6PDH4.pdb.gz	RNB3L_MOUSE Ran-binding protein 3-like OS=Mus musculus OX=10090 GN=Ranbp3l PE=1 SV=1
16	AFDB:Q9XTS1	0.114	0.176	9.654E-4	722	0.060	0.097	Q9XTS1.pdb.gz	Q9XTS1_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F47G4.4 PE=1 SV=1
17	AFDB:Q9LTT9	0.157	0.139	1.600E-3	1340	0.067	0.058	Q9LTT9.pdb.gz	VCR_ARATH Varicose-related protein OS=Arabidopsis thaliana OX=3702 GN=VCR PE=2 SV=1
18	AFDB:O14306	0.133	0.130	3.248E-3	1191	0.064	0.063	O14306.pdb.gz	YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9G1.10c PE=1 SV=2
19	AFDB:Q8IWE5	0.076	0.087	4.182E-3	1019	0.070	0.080	Q8IWE5.pdb.gz	PKHM2_HUMAN Pleckstrin homology domain-containing family M member 2 OS=Homo sapiens OX=9606 GN=PLEKHM2 PE=1 SV=2
20	AFDB:Q8VBV4	0.134	0.199	4.867E-3	710	0.075	0.123	Q8VBV4.pdb.gz	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z6L1	0.0	2394	1165	1.000	1.000	TCPR1_HUMAN Tectonin beta-propeller repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=TECPR1 PE=1 SV=1
2	O15040	2.45e-09	64.3	1411	0.044	0.036	TCPR2_HUMAN Tectonin beta-propeller repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=TECPR2 PE=1 SV=4
3	Q57X24	1.3	35.8	4810	0.021	0.005	Q57X24_TRYB2 Peroxin/Ferlin domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.190 PE=3 SV=1
4	P36010	2.3	33.5	153	0.021	0.163	NDK_YEAST Nucleoside diphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNK1 PE=1 SV=1
5	Q72AT3	3.8	33.9	445	0.016	0.043	Q72AT3_DESVH UDP-glucose 6-dehydrogenase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=ugd PE=1 SV=1
6	Q9VB49	5.4	33.5	775	0.022	0.034	Q9VB49_DROME Martik, isoform A OS=Drosophila melanogaster OX=7227 GN=mrt PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06462 Hyd_WA	1e-75	260.4	Propeller
2	PF08719 NADAR	3.6e+02	12.8	NADAR domain
3	PF06398 Pex24p	2e-14	65.0	Integral peroxisomal membrane peroxin
4	PF00169 PH	37	16.2	PH domain
5	PF19193 Tectonin	1e-45	167.3	Tectonin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404923

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358072	0.999	Autophagy protein 5
2	9606.ENSP00000425107	0.994	Ubiquitin-like protein ATG12
3	9606.ENSP00000288828	0.974	WD repeat domain phosphoinositide-interacting protein 2
4	9606.ENSP00000262139	0.896	WD repeat domain phosphoinositide-interacting protein 1
5	9606.ENSP00000375872	0.731	Autophagy-related protein 16-1
6	9606.ENSP00000283290	0.669	Ubiquitin-like-conjugating enzyme ATG3
7	9606.ENSP00000324318	0.669	Trafficking protein particle complex subunit 12
8	9606.ENSP00000037243	0.629	Gamma-aminobutyric acid receptor-associated protein-like 2
9	9606.ENSP00000376167	0.571	COP9 signalosome complex subunit 1
10	9606.ENSP00000306866	0.569	Gamma-aminobutyric acid receptor-associated protein
11	9606.ENSP00000266458	0.568	Gamma-aminobutyric acid receptor-associated protein-like 1
12	9606.ENSP00000335371	0.562	Trafficking protein particle complex subunit 11
13	9606.ENSP00000349785	0.560	Microtubule-associated proteins 1A/1B light chain 3C
14	9606.ENSP00000283351	0.548	Trafficking protein particle complex subunit 8
15	9606.ENSP00000398523	0.520	Calcium-binding and coiled-coil domain-containing protein 2
16	9606.ENSP00000326340	0.505	Autophagy-related protein 16-2
17	9606.ENSP00000384259	0.501	Cysteine protease ATG4B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032266	1.000	phosphatidylinositol-3-phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0016236	0.988	macroautophagy
GO:0071840	0.987	cellular component organization or biogenesis
GO:0050789	0.985	regulation of biological process
GO:0010506	0.984	regulation of autophagy
GO:0016043	0.982	cellular component organization
GO:0051128	0.965	regulation of cellular component organization
GO:0016241	0.963	regulation of macroautophagy
GO:0022411	0.948	cellular component disassembly
GO:0043244	0.902	regulation of protein-containing complex disassembly
GO:0043933	0.838	protein-containing complex organization
GO:0097352	0.812	autophagosome maturation
GO:0033043	0.811	regulation of organelle organization
GO:1901096	0.381	regulation of autophagosome maturation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0000421	0.999	autophagosome membrane
GO:0005765	0.998	lysosomal membrane
GO:0005829	0.968	cytosol
GO:0012505	0.450	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]