StarFunc result for job id Q7Z6M3

User Input

>input (343 residues)
MWSHLNRLLFWSIFSSVTCRKAVLDCEAMKTNEFPSPCLDSKTKVVMKGQNVSMFCSHKN
KSLQITYSLFRRKTHLGTQDGKGEPAIFNLSITEAHESGPYKCKAQVTSCSKYSRDFSFT
IVDPVTSPVLNIMVIQTETDRHITLHCLSVNGSLPINYTFFENHVAISPAISKYDREPAE
FNLTKKNPGEEEEYRCEAKNRLPNYATYSHPVTMPSTGGDSCPFCLKLLLPGLLLLLVVI
ILILAFWVLPKYKTRKAMRNNVPRDRGDTAMEVGIYANILEKQAKEESVPEVGSRPCVST
AQDEAKHSQELQYATPVFQEVAPREQEACDSYKSGYVYSELNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z6M3	1.000	1.000	1.062E-59	343	1.000	1.000	Q7Z6M3.pdb.gz	MILR1_HUMAN Allergin-1 OS=Homo sapiens OX=9606 GN=MILR1 PE=1 SV=2
2	AFDB:Q96LA5	0.365	0.265	5.337E-16	508	0.184	0.124	Q96LA5.pdb.gz	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
3	AFDB:Q96P31	0.333	0.180	2.975E-15	734	0.201	0.094	Q96P31.pdb.gz	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
4	AFDB:Q3TB92	0.262	0.363	4.333E-15	246	0.294	0.411	Q3TB92.pdb.gz	MILR1_MOUSE Allergin-1 OS=Mus musculus OX=10090 GN=Milr1 PE=1 SV=2
5	AFDB:Q96LA6	0.332	0.280	1.276E-13	429	0.178	0.142	Q96LA6.pdb.gz	FCRL1_HUMAN Fc receptor-like protein 1 OS=Homo sapiens OX=9606 GN=FCRL1 PE=1 SV=1
6	AFDB:P16284	0.323	0.174	3.180E-13	738	0.192	0.089	P16284.pdb.gz	PECA1_HUMAN Platelet endothelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=PECAM1 PE=1 SV=2
7	AFDB:Q96RD9	0.368	0.152	8.358E-13	977	0.213	0.075	Q96RD9.pdb.gz	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
8	AFDB:Q68SN8	0.335	0.217	1.217E-12	596	0.210	0.121	Q68SN8.pdb.gz	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
9	AFDB:P08101	0.231	0.236	3.200E-12	330	0.195	0.203	P08101.pdb.gz	FCGR2_MOUSE Low affinity immunoglobulin gamma Fc region receptor II OS=Mus musculus OX=10090 GN=Fcgr2 PE=1 SV=2
10	AFDB:Q08481	0.328	0.178	3.563E-12	727	0.160	0.076	Q08481.pdb.gz	PECA1_MOUSE Platelet endothelial cell adhesion molecule OS=Mus musculus OX=10090 GN=Pecam1 PE=1 SV=1
11	PDB:1otsD	0.200	0.284	3.399E-7	211	0.096	0.156	1otsD.pdb.gz	Gating the Selectivity Filter in ClC Chloride Channels
12	PDB:1orqA	0.185	0.273	9.949E-7	215	0.085	0.135	1orqA.pdb.gz
13	PDB:1ct8A	0.186	0.275	1.108E-6	214	0.090	0.145	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
14	PDB:1uwxL	0.200	0.302	1.233E-6	211	0.076	0.123	1uwxL.pdb.gz	Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.
15	PDB:1kc5L	0.210	0.299	1.449E-6	214	0.085	0.136	1kc5L.pdb.gz	Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response.
16	PDB:1a3lL	0.204	0.301	1.529E-6	217	0.087	0.138	1a3lL.pdb.gz	An antibody exo Diels-Alderase inhibitor complex at 1.95 angstrom resolution.
17	PDB:2ajsL	0.205	0.306	1.796E-6	216	0.090	0.144	2ajsL.pdb.gz	Complete reaction cycle of a cocaine catalytic antibody at atomic resolution.
18	PDB:5esvL	0.189	0.278	1.999E-6	214	0.076	0.121	5esvL.pdb.gz	Structures of HIV-1 Env V1V2 with broadly neutralizing antibodies reveal commonalities that enable vaccine design.
19	PDB:1k4dB	0.187	0.275	2.226E-6	212	0.087	0.142	1k4dB.pdb.gz
20	PDB:4xnzL	0.184	0.256	2.226E-6	207	0.082	0.135	4xnzL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z6M3	0.0	719	343	1.000	1.000	MILR1_HUMAN Allergin-1 OS=Homo sapiens OX=9606 GN=MILR1 PE=1 SV=2
2	Q3TB92	2.23e-30	117	246	0.166	0.232	MILR1_MOUSE Allergin-1 OS=Mus musculus OX=10090 GN=Milr1 PE=1 SV=2
3	Q96P31	8.28e-12	68.6	734	0.169	0.079	FCRL3_HUMAN Fc receptor-like protein 3 OS=Homo sapiens OX=9606 GN=FCRL3 PE=1 SV=1
4	Q96RD9	7.92e-11	65.9	977	0.149	0.052	FCRL5_HUMAN Fc receptor-like protein 5 OS=Homo sapiens OX=9606 GN=FCRL5 PE=1 SV=3
5	Q96LA5	1.27e-10	64.7	508	0.166	0.112	FCRL2_HUMAN Fc receptor-like protein 2 OS=Homo sapiens OX=9606 GN=FCRL2 PE=1 SV=1
6	Q68SN8	4.86e-09	60.1	596	0.169	0.097	FCRL5_MOUSE Fc receptor-like protein 5 OS=Mus musculus OX=10090 GN=Fcrl5 PE=1 SV=3
7	P51866	2.80e-06	51.6	739	0.137	0.064	PECA1_BOVIN Platelet endothelial cell adhesion molecule OS=Bos taurus OX=9913 GN=PECAM1 PE=1 SV=1
8	Q96LA6	6.58e-06	50.1	429	0.131	0.105	FCRL1_HUMAN Fc receptor-like protein 1 OS=Homo sapiens OX=9606 GN=FCRL1 PE=1 SV=1
9	P16284	2.28e-05	48.5	738	0.140	0.065	PECA1_HUMAN Platelet endothelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=PECAM1 PE=1 SV=2
10	Q90Y50	2.86e-05	47.8	372	0.099	0.091	CXAR_DANRE Coxsackievirus and adenovirus receptor homolog OS=Danio rerio OX=7955 GN=cxadr PE=2 SV=1
11	Q08481	9.96e-05	46.6	727	0.125	0.059	PECA1_MOUSE Platelet endothelial cell adhesion molecule OS=Mus musculus OX=10090 GN=Pecam1 PE=1 SV=1
12	A1YIY0	1.86e-04	44.7	268	0.149	0.190	FCRL6_MOUSE Fc receptor-like protein 6 OS=Mus musculus OX=10090 GN=Fcrl6 PE=2 SV=2
13	Q9Y624	0.006	40.4	299	0.157	0.181	JAM1_HUMAN Junctional adhesion molecule A OS=Homo sapiens OX=9606 GN=F11R PE=1 SV=1
14	Q3SWT0	0.030	38.5	678	0.122	0.062	PECA1_RAT Platelet endothelial cell adhesion molecule OS=Rattus norvegicus OX=10116 GN=Pecam1 PE=1 SV=1
15	G3V9P5	0.036	38.1	475	0.108	0.078	G3V9P5_RAT Pregnancy specific glycoprotein 19 OS=Rattus norvegicus OX=10116 GN=Psg19 PE=4 SV=3
16	Q9CX63	0.049	37.4	252	0.122	0.167	IL40_MOUSE Protein IL-40 OS=Mus musculus OX=10090 PE=2 SV=1
17	Q96RW7	0.058	38.1	5635	0.096	0.006	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
18	Q925P2	0.096	37.0	520	0.122	0.081	CEAM2_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Ceacam2 PE=1 SV=3
19	P31809	0.30	35.4	521	0.111	0.073	CEAM1_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ceacam1 PE=1 SV=1
20	F7FEB4	0.33	35.0	352	0.114	0.111	F7FEB4_RAT Pregnancy specific glycoprotein 19 OS=Rattus norvegicus OX=10116 GN=Psg19 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16262 DUF4916	5.9e+02	11.4	Domain of unknown function (DUF4916)
2	PF07679 I-set	28	16.2	Immunoglobulin I-set domain
3	PF00047 ig	0.096	24.2	Immunoglobulin domain
4	PF13895 Ig_2	1.7e-08	45.9	Immunoglobulin domain
5	PF13927 Ig_3	8.5e-05	34.4	Immunoglobulin domain
6	PF17736 Ig_C17orf99	2.2e-13	61.4	C17orf99 Ig domain
7	PF15330 SIT	2	20.3	SHP2-interacting transmembrane adaptor protein, SIT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005584765.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005552618.1	0.551	KHDC3-like protein
2	9541.XP_005563804.1	0.517	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0019222	0.981	regulation of metabolic process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0048523	0.966	negative regulation of cellular process
GO:0009893	0.961	positive regulation of metabolic process
GO:0050865	0.925	regulation of cell activation
GO:0002694	0.923	regulation of leukocyte activation
GO:0050896	0.907	response to stimulus
GO:0032501	0.904	multicellular organismal process
GO:0010604	0.884	positive regulation of macromolecule metabolic process
GO:0002376	0.848	immune system process
GO:0031323	0.831	regulation of cellular metabolic process
GO:0080090	0.829	regulation of primary metabolic process
GO:0051171	0.825	regulation of nitrogen compound metabolic process
GO:0048522	0.796	positive regulation of cellular process
GO:0031325	0.767	positive regulation of cellular metabolic process
GO:0048583	0.758	regulation of response to stimulus
GO:0010468	0.737	regulation of gene expression
GO:0001775	0.686	cell activation
GO:0051173	0.681	positive regulation of nitrogen compound metabolic process
GO:0010562	0.515	positive regulation of phosphorus metabolic process
GO:0045937	0.500	positive regulation of phosphate metabolic process
GO:0051716	0.498	cellular response to stimulus
GO:0051241	0.496	negative regulation of multicellular organismal process
GO:0051246	0.482	regulation of protein metabolic process
GO:0023052	0.475	signaling
GO:0007154	0.475	cell communication
GO:0007165	0.474	signal transduction
GO:0042325	0.435	regulation of phosphorylation
GO:0009966	0.426	regulation of signal transduction
GO:0031401	0.425	positive regulation of protein modification process
GO:0009892	0.419	negative regulation of metabolic process
GO:0010605	0.396	negative regulation of macromolecule metabolic process
GO:0032879	0.384	regulation of localization
GO:0001932	0.382	regulation of protein phosphorylation
GO:0048584	0.365	positive regulation of response to stimulus
GO:0019219	0.349	regulation of nucleobase-containing compound metabolic process
GO:0045321	0.345	leukocyte activation
GO:0048856	0.311	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0016020	0.998	membrane
GO:0071944	0.994	cell periphery
GO:0005737	0.981	cytoplasm
GO:0043226	0.978	organelle
GO:0043229	0.968	intracellular organelle
GO:0005886	0.952	plasma membrane
GO:0043227	0.826	membrane-bounded organelle
GO:0009986	0.688	cell surface
GO:0043231	0.687	intracellular membrane-bounded organelle
GO:0005615	0.366	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]