StarFunc result for job id Q7Z6M4

User Input

>input (381 residues)
MAAFGRQVLDWHRLIPLTWACMARQTPHLGEQRRTTASLLRKLTTASNGGVIEELSCVRS
NNYVQEPECRRNLVQCLLEKQGTPVVQGSLELERVMSSLLDMGFSNAHINELLSVRRGAS
LQQLLDIISEFILLGLNPEPVCVVLKKSPQLLKLPIMQMRKRSSYLQKLGLGEGKLKRVL
YCCPEIFTMRQQDINDTVRLLKEKCLFTVQQVTKILHSCPSVLREDLGQLEYKFQYAYFR
MGIKHPDIVKSEYLQYSLTKIKQRHIYLERLGRYQTPDKKGQTQIPNPLLKDILRVSEAE
FLARTACTSVEEFQVFKKLLAREEEESESSTSDDKRASLDEDEDDDDEEDNDEDDNDEDD
DDEDDDEAEDNDEDEDDDEEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z6M4	1.000	1.000	4.378E-47	381	1.000	1.000	Q7Z6M4.pdb.gz	MTEF4_HUMAN Transcription termination factor 4, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=3
2	AFDB:Q8BVN4	0.665	0.731	2.847E-30	346	0.572	0.630	Q8BVN4.pdb.gz	MTEF4_MOUSE Transcription termination factor 4, mitochondrial OS=Mus musculus OX=10090 GN=Mterf4 PE=2 SV=1
3	PDB:7pd3y	0.610	0.931	3.574E-27	245	0.640	0.996	7pd3y.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
4	AFDB:H7C316	0.436	0.639	2.057E-25	257	0.598	0.887	H7C316.pdb.gz	H7C316_HUMAN Mitochondrial transcription termination factor 4 (Fragment) OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=1
5	AFDB:E7EW93	0.253	0.385	4.019E-17	249	0.454	0.695	E7EW93.pdb.gz	E7EW93_HUMAN Mitochondrial transcription termination factor 4 OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=1
6	AFDB:Q9VPD5	0.458	0.491	3.378E-9	354	0.165	0.178	Q9VPD5.pdb.gz	MTEF3_DROME Transcription termination factor 3, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mTerf3 PE=2 SV=1
7	AFDB:Q96E29	0.447	0.412	6.017E-9	417	0.173	0.158	Q96E29.pdb.gz	MTEF3_HUMAN Transcription termination factor 3, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF3 PE=1 SV=2
8	AFDB:Q8R3J4	0.446	0.415	7.853E-9	412	0.194	0.180	Q8R3J4.pdb.gz	MTEF3_MOUSE Transcription termination factor 3, mitochondrial OS=Mus musculus OX=10090 GN=Mterf3 PE=2 SV=1
9	AFDB:Q9FM80	0.275	0.224	2.007E-7	496	0.171	0.131	Q9FM80.pdb.gz	MTEF9_ARATH Transcription termination factor MTERF9, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF9 PE=2 SV=1
10	AFDB:Q3ED83	0.265	0.260	1.691E-6	390	0.150	0.146	Q3ED83.pdb.gz	Q3ED83_ARATH Mitochondrial transcription termination factor family protein OS=Arabidopsis thaliana OX=3702 GN=MTERF27 PE=1 SV=1
11	AFDB:Q99551	0.340	0.327	2.124E-5	399	0.118	0.113	Q99551.pdb.gz	MTEF1_HUMAN Transcription termination factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF1 PE=1 SV=1
12	PDB:4cj9A	0.347	0.195	1.441E-1	752	0.087	0.044	4cj9A.pdb.gz
13	PDB:7zs9M	0.151	0.173	1.515	310	0.063	0.077	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
14	PDB:1zp2A	0.132	0.184	1.978	227	0.050	0.084	1zp2A.pdb.gz
15	PDB:5t04A	0.114	0.100	2.161	458	0.071	0.059	5t04A.pdb.gz	Structure and dynamics of a constitutively active neurotensin receptor.
16	PDB:5iy7M	0.157	0.183	2.581	310	0.050	0.061	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
17	PDB:1rqiA	0.133	0.152	2.699	300	0.092	0.117	1rqiA.pdb.gz	Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
18	PDB:6lfmR	0.106	0.121	2.821	307	0.060	0.075	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.
19	PDB:7lciR	0.102	0.099	2.949	393	0.092	0.089	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
20	PDB:5iy6M	0.101	0.128	3.522	260	0.060	0.088	5iy6M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z6M4	0.0	778	381	1.000	1.000	MTEF4_HUMAN Transcription termination factor 4, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=3
2	B4DKD5	3.14e-174	487	252	0.617	0.933	B4DKD5_HUMAN Mitochondrial transcription termination factor 4 OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=1
3	H7C316	3.57e-167	469	257	0.598	0.887	H7C316_HUMAN Mitochondrial transcription termination factor 4 (Fragment) OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=1
4	Q8BVN4	2.54e-154	440	346	0.559	0.616	MTEF4_MOUSE Transcription termination factor 4, mitochondrial OS=Mus musculus OX=10090 GN=Mterf4 PE=2 SV=1
5	B5MBW3	3.97e-125	360	182	0.454	0.951	B5MBW3_HUMAN Mitochondrial transcription termination factor 4 (Fragment) OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=2
6	E7EW93	7.14e-124	359	249	0.454	0.695	E7EW93_HUMAN Mitochondrial transcription termination factor 4 OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=1
7	C9JX74	1.23e-104	306	151	0.396	1.000	C9JX74_HUMAN Mitochondrial transcription termination factor 4 (Fragment) OS=Homo sapiens OX=9606 GN=MTERF4 PE=1 SV=1
8	Q96E29	4.37e-08	57.0	417	0.121	0.110	MTEF3_HUMAN Transcription termination factor 3, mitochondrial OS=Homo sapiens OX=9606 GN=MTERF3 PE=1 SV=2
9	Q9VPD5	6.12e-06	50.1	354	0.118	0.127	MTEF3_DROME Transcription termination factor 3, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mTerf3 PE=2 SV=1
10	Q8R3J4	8.09e-06	50.1	412	0.118	0.109	MTEF3_MOUSE Transcription termination factor 3, mitochondrial OS=Mus musculus OX=10090 GN=Mterf3 PE=2 SV=1
11	B6TGN4	0.007	40.8	494	0.234	0.180	MTEF4_MAIZE Transcription termination factor MTERF4, chloroplastic OS=Zea mays OX=4577 GN=MTERF4 PE=2 SV=1
12	Q8I3A0	0.013	40.4	2568	0.050	0.007	Q8I3A0_PLAF7 Copper-transporting ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0904900 PE=4 SV=2
13	Q9ZT96	0.023	39.3	541	0.178	0.126	MTEF4_ARATH Transcription termination factor MTERF4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF4 PE=1 SV=1
14	F4JVI3	0.031	38.9	493	0.089	0.069	MTEF5_ARATH Transcription termination factor MTERF5, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=MTERF5 PE=1 SV=1
15	O17003	0.43	35.4	799	0.058	0.028	O17003_CAEEL Protein MAK10 homolog OS=Caenorhabditis elegans OX=6239 GN=natc-1 PE=1 SV=2
16	Q54CF8	1.3	33.9	3071	0.039	0.005	Q54CF8_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293012 PE=4 SV=1
17	Q8RXC3	1.3	33.5	666	0.055	0.032	Q8RXC3_ARATH Aminotransferase-like, plant mobile domain family protein OS=Arabidopsis thaliana OX=3702 GN=DL4065W PE=2 SV=1
18	Q8I398	1.8	33.5	2112	0.034	0.006	Q8I398_PLAF7 Nucleoporin NUP221, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0905100 PE=4 SV=1
19	Q8IK84	2.8	32.7	5906	0.037	0.002	Q8IK84_PLAF7 Cysteine repeat modular protein 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1475400 PE=4 SV=2
20	Q7K734	6.0	31.6	672	0.047	0.027	FEN1_PLAF7 Flap endonuclease 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=FEN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04889 Cwf_Cwc_15	4.4	18.6	Cwf15/Cwc15 cell cycle control protein
2	PF02536 mTERF	4e-14	63.9	mTERF
3	PF09184 PPP4R2	5.5e+02	11.5	PPP4R2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480378

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419740	0.999	5-methylcytosine rRNA methyltransferase NSUN4
2	9606.ENSP00000248643	0.817	Transcription termination factor 1, mitochondrial
3	9606.ENSP00000359859	0.809	Mitochondrial ribosome-associated GTPase 2
4	9606.ENSP00000447651	0.808	Transcription termination factor 2, mitochondrial
5	9606.ENSP00000481559	0.736	rRNA methyltransferase 1, mitochondrial
6	9606.ENSP00000306080	0.735	rRNA methyltransferase 3, mitochondrial
7	9606.ENSP00000215941	0.734	Ankyrin repeat domain-containing protein 54
8	9606.ENSP00000419370	0.717	Mitochondrial assembly of ribosomal large subunit protein 1
9	9606.ENSP00000254940	0.708	60S ribosome subunit biogenesis protein NIP7 homolog
10	9606.ENSP00000356134	0.706	Dimethyladenosine transferase 1, mitochondrial
11	9606.ENSP00000401191	0.686	Probable 18S rRNA (guanine-N(7))-methyltransferase
12	9606.ENSP00000372804	0.684	mRNA cap guanine-N7 methyltransferase
13	9606.ENSP00000465759	0.679	DNA-directed RNA polymerase, mitochondrial
14	9606.ENSP00000298317	0.660	Mitochondrial RNA pseudouridine synthase RPUSD4
15	9606.ENSP00000264230	0.657	Nitric oxide-associated protein 1
16	9606.ENSP00000223324	0.656	Mitochondrial ribosomal protein L32
17	9606.ENSP00000361084	0.652	39S ribosomal protein L14, mitochondrial
18	9606.ENSP00000301585	0.651	Peptidyl-tRNA hydrolase ICT1, mitochondrial
19	9606.ENSP00000323047	0.644	Mitochondrial ribosome-associated GTPase 1
20	9606.ENSP00000355471	0.618	Dimethyladenosine transferase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019843	1.000	rRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.992	primary metabolic process
GO:0044237	0.991	cellular metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0010467	0.980	gene expression
GO:0016070	0.975	RNA metabolic process
GO:0019438	0.971	aromatic compound biosynthetic process
GO:0071840	0.969	cellular component organization or biogenesis
GO:0044271	0.954	cellular nitrogen compound biosynthetic process
GO:0006996	0.948	organelle organization
GO:0051179	0.935	localization
GO:0044085	0.927	cellular component biogenesis
GO:0140053	0.855	mitochondrial gene expression
GO:0000959	0.818	mitochondrial RNA metabolic process
GO:0009059	0.694	macromolecule biosynthetic process
GO:0042254	0.689	ribosome biogenesis
GO:0065007	0.583	biological regulation
GO:0032774	0.565	RNA biosynthetic process
GO:0006351	0.561	DNA-templated transcription
GO:0050789	0.545	regulation of biological process
GO:0007005	0.524	mitochondrion organization
GO:0050794	0.473	regulation of cellular process
GO:0140694	0.468	non-membrane-bounded organelle assembly
GO:0042255	0.454	ribosome assembly
GO:0019222	0.449	regulation of metabolic process
GO:0051171	0.426	regulation of nitrogen compound metabolic process
GO:0060255	0.415	regulation of macromolecule metabolic process
GO:0080090	0.414	regulation of primary metabolic process
GO:0031323	0.414	regulation of cellular metabolic process
GO:0015031	0.395	protein transport
GO:0010468	0.388	regulation of gene expression
GO:0051649	0.379	establishment of localization in cell
GO:0033365	0.376	protein localization to organelle
GO:0046907	0.366	intracellular transport
GO:0010556	0.363	regulation of macromolecule biosynthetic process
GO:0031326	0.363	regulation of cellular biosynthetic process
GO:0048856	0.355	anatomical structure development
GO:0006886	0.346	intracellular protein transport
GO:0043010	0.336	camera-type eye development
GO:0072594	0.331	establishment of protein localization to organelle
GO:0070585	0.329	protein localization to mitochondrion
GO:0006605	0.329	protein targeting
GO:0006839	0.325	mitochondrial transport
GO:0072655	0.321	establishment of protein localization to mitochondrion
GO:0072359	0.309	circulatory system development
GO:0006626	0.304	protein targeting to mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0005829	0.997	cytosol
GO:0070013	0.997	intracellular organelle lumen
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0032991	0.990	protein-containing complex
GO:0005759	0.982	mitochondrial matrix
GO:1990904	0.947	ribonucleoprotein complex
GO:0098798	0.936	mitochondrial protein-containing complex
GO:0005840	0.916	ribosome
GO:0000313	0.913	organellar ribosome
GO:0044391	0.861	ribosomal subunit
GO:0005761	0.800	mitochondrial ribosome
GO:0015934	0.765	large ribosomal subunit
GO:0000315	0.762	organellar large ribosomal subunit
GO:0005762	0.738	mitochondrial large ribosomal subunit
GO:0005634	0.439	nucleus
GO:0031981	0.433	nuclear lumen
GO:0005654	0.313	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]