StarFunc result for job id Q7Z6P3

User Input

>input (1021 residues)
METGQRTSRKVRKLGSNRRRQTREPADGEGAAVAPEPESWSSQAAAELQAFFQDCGAKER
GFVTREDLAVAKFSFLGSKEESEMIFDWVDVERKGHLSLEEFSSGLKNIFGSSQSPHRLR
RRKPLPSKRVSATTSFPALEEADAEEKEAFLAFMEQLGTGHLLPKQMEIWQLWGQLRQEE
PQLAGNLAGFLAKMTSRLQEAQADKEALELTLRKRDSDHHREVQQLYEEMEQQIRQEKQQ
LQAESDSRGLALTSQMQDVLEAKEREVQRLAEGQRELEAQLSHLRSTHQEAASENQQLQE
AKRDLAGRLEEVRGQLQVTRGRLDAARGRVSWQVEEKLSFPGAGEKTPDPQAASPEEAPL
PGLFGDNDDWDQLLSNFGSPPHGALQLCWSPPPTPRATSGPQTPRVVRQISISEPQAFLF
GQEPSSDPDGAPRTPPGVTFSAKDNKGVDPHEQDIRAEQPVEPHDPDPNQEPGSTPEGRL
LWGLSGSLVAPAFKVLIPLEDGPPPPANSPPPQAPAGSSKQIQASDPDDKGPGSWAPPSG
AQPGAGAGPQEPTQTPPTMTERETQPGPSPTTALTGVGPAKPPRQRDALQQDLHATGSEP
RLGTQRARALTLGPAEPFQGLEFVGPVPTERLEQGQAGPAVQEGLPEGLREAHGQVLGLG
ELSAFPHQELEEEPRSEEGKQEGRGGQDLSSEQSEQSVEAHGLETAHSELPQQDSLLVSL
PSATPQAQVEAEGPTPGKSAPPRGSPPRGAQPGAGAGPQEPTQTPPTMAEQEAQPRPSLT
TAHAEEQGPPHSREPRAESRLEDPGMDSREAGLTPSPGDPMAGGGPQANPDYLFHVIFLG
DSNVGKTSFLHLLHQNSFATGLTATVGVDFRVKTLLVDNKCFVLQLWDTAGQERYHSMTR
QLLRKADGVVLMYDITSQESFAHVRYWLDCLQDAGSDGVVILLLGNKMDCEEERQVSVEA
GQQLAQELGVYFGECSAALGHNILEPVVNLARSLRMQEEGLKDSLVKVAPKRPPKRFGCC
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z6P3	1.000	1.000	0.000	1021	1.000	1.000	Q7Z6P3.pdb.gz	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
2	AFDB:Q8CB87	0.272	0.283	1.759E-89	973	0.603	0.633	Q8CB87.pdb.gz	RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus OX=10090 GN=Rab44 PE=1 SV=2
3	PDB:1zbdA	0.169	0.941	1.288E-20	177	0.074	0.429	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
4	PDB:5sziA	0.166	0.956	1.451E-20	174	0.066	0.385	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
5	PDB:2ew1A	0.163	0.925	6.088E-20	171	0.061	0.363	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
6	PDB:5szjA	0.165	0.939	9.249E-20	175	0.065	0.377	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
7	PDB:8a4cB	0.164	0.966	1.042E-19	170	0.071	0.424	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
8	PDB:2zetA	0.166	0.906	2.878E-19	181	0.070	0.392	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
9	PDB:5szhB	0.168	0.948	7.948E-19	175	0.061	0.354	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
10	PDB:6if2B	0.168	0.921	7.696E-18	178	0.062	0.354	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
11	PDB:2f9mA	0.170	0.907	1.485E-17	182	0.061	0.341	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
12	PDB:3cwzA	0.155	0.918	3.041E-17	166	0.062	0.380	3cwzA.pdb.gz	Structural basis for recruitment of Rab6-interacting protein 1 to Golgi via a RUN domain.
13	AFDB:A1ZBJ6	0.150	0.113	2.291E-8	1379	0.125	0.093	A1ZBJ6.pdb.gz	A1ZBJ6_DROME Rad, Gem/Kir family member 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Rgk1 PE=4 SV=2
14	AFDB:O95819	0.116	0.099	1.290E-5	1239	0.124	0.103	O95819.pdb.gz	M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP4K4 PE=1 SV=2
15	AFDB:A0A0G2K490	0.068	0.056	1.454E-5	1360	0.141	0.106	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
16	AFDB:F1LP90	0.083	0.068	1.788E-4	1336	0.121	0.093	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
17	AFDB:G4SNP7	0.083	0.063	2.716E-4	1427	0.106	0.076	G4SNP7.pdb.gz	G4SNP7_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=3
18	AFDB:Q13625	0.079	0.073	4.126E-4	1128	0.142	0.129	Q13625.pdb.gz	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
19	AFDB:F1M754	0.067	0.060	7.962E-4	1178	0.115	0.099	F1M754.pdb.gz	F1M754_RAT Mitogen-activated protein kinase kinase kinase kinase 4 OS=Rattus norvegicus OX=10116 GN=Map4k4 PE=1 SV=3
20	AFDB:P08553	0.077	0.088	1.011E-3	848	0.124	0.150	P08553.pdb.gz	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z6P3	0.0	2043	1021	1.000	1.000	RAB44_HUMAN Ras-related protein Rab-44 OS=Homo sapiens OX=9606 GN=RAB44 PE=1 SV=4
2	Q8CB87	0.0	1054	973	0.610	0.640	RAB44_MOUSE Ras-related protein Rab-44 OS=Mus musculus OX=10090 GN=Rab44 PE=1 SV=2
3	Q3UP38	6.05e-57	212	726	0.095	0.134	EFC4B_MOUSE EF-hand calcium-binding domain-containing protein 4B OS=Mus musculus OX=10090 GN=Cracr2a PE=2 SV=2
4	Q9BSW2	1.38e-55	208	731	0.096	0.134	EFC4B_HUMAN EF-hand calcium-binding domain-containing protein 4B OS=Homo sapiens OX=9606 GN=CRACR2A PE=1 SV=2
5	P17609	5.25e-44	160	200	0.072	0.370	YPT2_SCHPO GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypt2 PE=3 SV=1
6	Q8IZ41	3.68e-42	168	740	0.082	0.114	RASEF_HUMAN Ras and EF-hand domain-containing protein OS=Homo sapiens OX=9606 GN=RASEF PE=1 SV=1
7	O18338	1.32e-41	153	207	0.072	0.357	O18338_DROME LD44762p OS=Drosophila melanogaster OX=7227 GN=Rab8 PE=1 SV=1
8	Q94148	2.53e-41	152	201	0.073	0.373	RAB10_CAEEL Ras-related protein Rab-10 OS=Caenorhabditis elegans OX=6239 GN=rab-10 PE=1 SV=2
9	P59190	7.76e-41	151	212	0.074	0.358	RAB15_HUMAN Ras-related protein Rab-15 OS=Homo sapiens OX=9606 GN=RAB15 PE=1 SV=1
10	A5PLC7	4.00e-40	149	209	0.068	0.330	A5PLC7_DANRE RAB8B, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8bb PE=1 SV=1
11	Q4W9I4	4.48e-40	149	206	0.070	0.345	Q4W9I4_ASPFU Rab GTPase SrgA, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G04810 PE=4 SV=1
12	A2R2A0	5.13e-40	149	206	0.070	0.345	A2R2A0_ASPNC Secretion related GTPase srgA-Aspergillus niger OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=srgA PE=4 SV=1
13	Q7T3A4	5.16e-40	149	200	0.068	0.345	RAB13_DANRE Ras-related protein Rab-13 OS=Danio rerio OX=7955 GN=rab13 PE=1 SV=1
14	G5EFC1	6.00e-40	149	211	0.069	0.332	G5EFC1_CAEEL Rab8 OS=Caenorhabditis elegans OX=6239 GN=rab-8 PE=1 SV=1
15	P25228	1.26e-39	148	220	0.072	0.336	RAB3_DROME Ras-related protein Rab-3 OS=Drosophila melanogaster OX=7227 GN=Rab3 PE=1 SV=1
16	Q92930	1.77e-39	147	207	0.067	0.329	RAB8B_HUMAN Ras-related protein Rab-8B OS=Homo sapiens OX=9606 GN=RAB8B PE=1 SV=2
17	P61028	1.80e-39	147	207	0.067	0.329	RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus OX=10090 GN=Rab8b PE=1 SV=1
18	P70550	1.80e-39	147	207	0.067	0.329	RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus OX=10116 GN=Rab8b PE=1 SV=1
19	P35289	3.72e-39	147	212	0.073	0.354	RAB15_RAT Ras-related protein Rab-15 OS=Rattus norvegicus OX=10116 GN=Rab15 PE=2 SV=1
20	A4FVK4	3.79e-39	146	207	0.066	0.324	A4FVK4_DANRE RAB8A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00025 Arf	1.3e-08	46.0	ADP-ribosylation factor family
2	PF15066 CAGE1	87	13.2	Cancer-associated gene protein 1 family
3	PF13499 EF-hand_7	11	17.8	EF-hand domain pair
4	PF13833 EF-hand_8	0.33	22.1	EF-hand domain pair
5	PF15665 FAM184	1.5e+02	13.6	Family with sequence similarity 184, A and B
6	PF02421 FeoB_N	4.4e+02	11.8	Ferrous iron transport protein B
7	PF00009 GTP_EFTU	8.2	17.4	Elongation factor Tu GTP binding domain
8	PF04670 Gtr1_RagA	0.0013	29.8	Gtr1/RagA G protein conserved region
9	PF01926 MMR_HSR1	0.013	27.0	50S ribosome-binding GTPase
10	PF00071 Ras	2.7e-44	162.1	Ras family
11	PF08477 Roc	2.2e-21	87.7	Ras of Complex, Roc, domain of DAPkinase
12	PF03193 RsgA_GTPase	2.4e+02	13.0	RsgA GTPase
13	PF09439 SRPRB	5.9	17.8	Signal recognition particle receptor beta subunit
14	PF07996 T4SS	1.4e+02	14.2	Type IV secretion system proteins
15	PF05615 THOC7	1.2e+02	14.4	Tho complex subunit 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481054

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261726	0.788	Homeobox protein cut-like 2
2	9606.ENSP00000337632	0.788	SAP domain-containing ribonucleoprotein
3	9606.ENSP00000353401	0.788	Homeobox protein cut-like 1
4	9606.ENSP00000447000	0.788	Uncharacterized protein
5	9606.ENSP00000309836	0.583	Coiled-coil domain-containing protein 13
6	9606.ENSP00000253861	0.505	Exocyst complex component 4
7	9606.ENSP00000390783	0.505	Sec1 family domain-containing protein 1
8	9606.ENSP00000218004	0.504	NTF2-related export protein 2
9	9606.ENSP00000394071	0.504	Rab GDP dissociation inhibitor alpha
10	9606.ENSP00000410734	0.504	Zinc finger protein 562

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.991	protein binding
GO:0003924	0.694	GTPase activity
GO:1901363	0.458	heterocyclic compound binding
GO:0097159	0.451	organic cyclic compound binding
GO:0043167	0.330	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0065007	0.984	biological regulation
GO:0051179	0.923	localization
GO:0051234	0.855	establishment of localization
GO:0006810	0.843	transport
GO:0050789	0.825	regulation of biological process
GO:0051641	0.750	cellular localization
GO:0050794	0.746	regulation of cellular process
GO:0050896	0.715	response to stimulus
GO:0051649	0.367	establishment of localization in cell
GO:0016192	0.321	vesicle-mediated transport
GO:0071840	0.301	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0071944	0.996	cell periphery
GO:0031982	0.995	vesicle
GO:0005886	0.994	plasma membrane
GO:0031410	0.994	cytoplasmic vesicle
GO:0031090	0.977	organelle membrane
GO:0098588	0.963	bounding membrane of organelle
GO:0099503	0.929	secretory vesicle
GO:0030141	0.924	secretory granule
GO:0005829	0.913	cytosol
GO:0005773	0.817	vacuole
GO:0000323	0.797	lytic vacuole
GO:0005764	0.787	lysosome
GO:0030659	0.725	cytoplasmic vesicle membrane
GO:0005766	0.689	primary lysosome
GO:0070013	0.584	intracellular organelle lumen
GO:0042582	0.549	azurophil granule
GO:0030667	0.533	secretory granule membrane
GO:0035579	0.471	specific granule membrane
GO:0098852	0.447	lytic vacuole membrane
GO:0005765	0.442	lysosomal membrane
GO:0035577	0.412	azurophil granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.694	GTP + H2O = GDP + H(+) + phosphate

[back to server]