StarFunc result for job id Q7Z6R9

User Input

>input (452 residues)
MSTTFPGLVHDAEIRHDGSNSYRLMQLGCLESVANSTVAYSSSSPLTYSTTGTEFASPYF
STNHQYTPLHHQSFHYEFQHSHPAVTPDAYSLNSLHHSQQYYQQIHHGEPTDFINLHNAR
ALKSSCLDEQRRELGCLDAYRRHDLSLMSHGSQYGMHPDQRLLPGPSLGLAAAGADDLQG
SVEAQCGLVLNGQGGVIRRGGTCVVNPTDLFCSVPGRLSLLSSTSKYKVTIAEVKRRLSP
PECLNASLLGGILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAANVTLLTSLVEGEALHL
ARDFGYTCETEFPAKAVGEHLARQHMEQKEQTARKKMILATKQICKEFQDLLSQDRSPLG
SSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQTVLSEMLNYLEKHTTHKNGGA
ADSGQGHANSEKAPLRKTSEAAVKEGKTEKTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z6R9	1.000	1.000	6.720E-61	452	1.000	1.000	Q7Z6R9.pdb.gz	AP2D_HUMAN Transcription factor AP-2-delta OS=Homo sapiens OX=9606 GN=TFAP2D PE=1 SV=1
2	AFDB:A0A6E1XE14	0.480	0.493	2.950E-30	439	0.462	0.476	A0A6E1XE14.pdb.gz	A0A6E1XE14_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
3	AFDB:A0A286Y8U3	0.482	0.496	6.206E-30	439	0.469	0.483	A0A286Y8U3.pdb.gz
4	AFDB:Q92481	0.487	0.479	4.292E-29	460	0.460	0.452	Q92481.pdb.gz	AP2B_HUMAN Transcription factor AP-2-beta OS=Homo sapiens OX=9606 GN=TFAP2B PE=1 SV=2
5	AFDB:G2HK15	0.429	0.522	2.627E-11	367	0.144	0.177	G2HK15.pdb.gz	APTF2_CAEEL Transcription factor aptf-2 OS=Caenorhabditis elegans OX=6239 GN=aptf-2 PE=1 SV=1
6	AFDB:Q5VUA4	0.080	0.028	1.914E-1	2279	0.144	0.029	Q5VUA4.pdb.gz	ZN318_HUMAN Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2
7	AFDB:Q9SJJ3	0.130	0.105	2.990E-1	584	0.135	0.104	Q9SJJ3.pdb.gz	BLH8_ARATH BEL1-like homeodomain protein 8 OS=Arabidopsis thaliana OX=3702 GN=BLH8 PE=1 SV=1
8	AFDB:Q86CW5	0.098	0.041	5.421E-1	1413	0.115	0.037	Q86CW5.pdb.gz	Q86CW5_DROME Hmr OS=Drosophila melanogaster OX=7227 GN=Hmr PE=4 SV=1
9	AFDB:F4J6F6	0.100	0.045	6.291E-1	1296	0.162	0.056	F4J6F6.pdb.gz	IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana OX=3702 GN=IREH1 PE=1 SV=1
10	AFDB:A0A0B4LGK0	0.070	0.031	8.061E-1	1198	0.155	0.058	A0A0B4LGK0.pdb.gz	A0A0B4LGK0_DROME Stac-like, isoform V OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
11	PDB:7d5sRO	0.071	0.064	1.055	525	0.082	0.070	7d5sRO.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
12	PDB:3jd5G	0.101	0.168	2.219	208	0.064	0.139	3jd5G.pdb.gz	Cryo-EM structure of the small subunit of the mammalian mitochondrial ribosome.
13	PDB:5wk5A	0.103	0.154	2.219	269	0.042	0.071	5wk5A.pdb.gz
14	PDB:6wfqC	0.099	0.151	2.705	228	0.053	0.105	6wfqC.pdb.gz	Mechanism of NanR gene repression and allosteric induction of bacterial sialic acid metabolism.
15	PDB:6vq9H	0.128	0.374	3.139	109	0.033	0.138	6vq9H.pdb.gz	Structure of V-ATPase from the mammalian brain.
16	PDB:6lk8B	0.070	0.063	3.299	532	0.069	0.058	6lk8B.pdb.gz
17	PDB:7twaB	0.081	0.147	3.467	223	0.066	0.135	7twaB.pdb.gz	Substrate-Triggered mu-Peroxodiiron(III) Intermediate in the 4-Chloro-l-Lysine-Fragmenting Heme-Oxygenase-like Diiron Oxidase (HDO) BesC: Substrate Dissociation from, and C4 Targeting by, the Intermediate.
18	PDB:6yvvB	0.087	0.083	3.643	480	0.064	0.060	6yvvB.pdb.gz
19	PDB:4gouA	0.089	0.080	4.023	507	0.044	0.039	4gouA.pdb.gz
20	PDB:4p9uE	0.103	0.146	4.023	272	0.064	0.107	4p9uE.pdb.gz	The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z6R9	0.0	933	452	1.000	1.000	AP2D_HUMAN Transcription factor AP-2-delta OS=Homo sapiens OX=9606 GN=TFAP2D PE=1 SV=1
2	Q91ZK0	0.0	930	452	0.996	0.996	AP2D_MOUSE Transcription factor AP-2-delta OS=Mus musculus OX=10090 GN=Tfap2d PE=1 SV=1
3	F1QUT4	2.71e-118	355	437	0.476	0.492	F1QUT4_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
4	A0A2R8QRQ5	5.86e-118	354	450	0.476	0.478	A0A2R8QRQ5_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
5	Q6NYI3	8.90e-118	353	425	0.480	0.511	Q6NYI3_DANRE Transcription factor AP-2-alpha OS=Danio rerio OX=7955 GN=ap2 PE=1 SV=1
6	O13111	1.34e-115	348	437	0.467	0.483	O13111_CHICK Transcription factor AP-2-alpha OS=Gallus gallus OX=9031 PE=2 SV=2
7	Q4TTV4	1.85e-115	347	439	0.493	0.508	Q4TTV4_DANRE Transcription factor AP-2 beta isoform OS=Danio rerio OX=7955 GN=zgc:110163 PE=2 SV=1
8	A0A6E1XE14	2.10e-115	347	439	0.471	0.485	A0A6E1XE14_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
9	P05549	2.51e-115	347	437	0.471	0.487	AP2A_HUMAN Transcription factor AP-2-alpha OS=Homo sapiens OX=9606 GN=TFAP2A PE=1 SV=1
10	P34056	2.67e-115	347	437	0.476	0.492	AP2A_MOUSE Transcription factor AP-2-alpha OS=Mus musculus OX=10090 GN=Tfap2a PE=1 SV=2
11	A0A0G2KAT2	4.65e-114	344	459	0.489	0.481	A0A0G2KAT2_RAT Transcription factor AP-2 beta OS=Rattus norvegicus OX=10116 GN=Tfap2b PE=3 SV=1
12	Q61313	4.65e-114	344	459	0.489	0.481	AP2B_MOUSE Transcription factor AP-2-beta OS=Mus musculus OX=10090 GN=Tfap2b PE=1 SV=2
13	D4A505	6.03e-114	343	441	0.487	0.499	D4A505_RAT Transcription factor AP-2 beta OS=Rattus norvegicus OX=10116 GN=Tfap2b PE=3 SV=2
14	P58197	1.16e-113	343	437	0.469	0.485	AP2A_RAT Transcription factor AP-2-alpha OS=Rattus norvegicus OX=10116 GN=Tfap2a PE=1 SV=1
15	Q92481	1.24e-113	343	460	0.493	0.485	AP2B_HUMAN Transcription factor AP-2-beta OS=Homo sapiens OX=9606 GN=TFAP2B PE=1 SV=2
16	O93346	1.45e-113	343	449	0.487	0.490	O93346_CHICK Transcription factor AP-2 beta OS=Gallus gallus OX=9031 PE=2 SV=1
17	Q5PQZ4	1.94e-112	340	445	0.358	0.364	Q5PQZ4_DANRE Transcription factor AP-2 gamma OS=Danio rerio OX=7955 GN=fb48g05 PE=1 SV=1
18	Q6VUP9	9.51e-110	333	442	0.361	0.369	AP2E_MOUSE Transcription factor AP-2-epsilon OS=Mus musculus OX=10090 GN=Tfap2e PE=1 SV=2
19	Q6P0E7	2.21e-109	331	423	0.440	0.470	AP2E_DANRE Transcription factor AP-2-epsilon OS=Danio rerio OX=7955 GN=tfap2e PE=2 SV=1
20	Q6VUC0	3.20e-108	329	442	0.347	0.355	AP2E_HUMAN Transcription factor AP-2-epsilon OS=Homo sapiens OX=9606 GN=TFAP2E PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03299 TF_AP-2	1.2e-79	278.3	Transcription factor AP-2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 185453.XP_006835768.1

Rank	PPI partner	STRING score	Description
1	185453.XP_006866939.1	0.850	Histone acetyltransferase p300
2	185453.XP_006874936.1	0.823	CREB-binding protein isoform X1
3	185453.XP_006872840.1	0.768	Activator of basal transcription 1
4	185453.XP_006834680.1	0.701	Cbp/p300-interacting transactivator 2
5	185453.XP_006860780.1	0.694	Zinc finger CCHC domain-containing protein 3
6	185453.XP_006834562.1	0.693	Spermatogenesis-associated protein 4
7	185453.XP_006835098.1	0.666	BTB/POZ domain-containing protein KCTD1 isoform X1
8	185453.XP_006876425.1	0.660	WW domain-containing transcription regulator protein 1
9	185453.XP_006859608.1	0.653	YEATS domain-containing protein 4
10	185453.XP_006867377.1	0.650	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
11	185453.XP_006832421.1	0.617	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 22 Proteins
12	185453.XP_006875751.1	0.617	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred complete CDS: substituted 1 base at 1 genomic stop codon
13	185453.XP_006875968.1	0.605	Nuclear receptor corepressor 1 isoform X1
14	185453.XP_006860022.1	0.604	set1/Ash2 histone methyltransferase complex subunit ASH2 isoform X1
15	185453.XP_006835510.1	0.600	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins
16	185453.XP_006859809.1	0.600	Transformation/transcription domain-associated protein isoform X1
17	185453.XP_006870973.1	0.600	Aryl hydrocarbon receptor nuclear translocator 2
18	185453.XP_006861443.1	0.598	Aryl hydrocarbon receptor nuclear translocator isoform X1
19	185453.XP_006874090.1	0.598	Zinc finger E-box-binding homeobox 1-like isoform X1
20	185453.XP_006864381.1	0.588	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0043565	0.999	sequence-specific DNA binding
GO:0000981	0.933	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003690	0.919	double-stranded DNA binding
GO:1990837	0.913	sequence-specific double-stranded DNA binding
GO:0001067	0.882	transcription regulatory region nucleic acid binding
GO:0000976	0.836	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0032502	0.974	developmental process
GO:0032501	0.973	multicellular organismal process
GO:0009987	0.960	cellular process
GO:0045944	0.958	positive regulation of transcription by RNA polymerase II
GO:0007275	0.945	multicellular organism development
GO:0048731	0.890	system development
GO:0048513	0.619	animal organ development
GO:0008152	0.463	metabolic process
GO:0071704	0.447	organic substance metabolic process
GO:0044238	0.403	primary metabolic process
GO:0048523	0.399	negative regulation of cellular process
GO:0009892	0.359	negative regulation of metabolic process
GO:0051172	0.350	negative regulation of nitrogen compound metabolic process
GO:0031324	0.344	negative regulation of cellular metabolic process
GO:0010605	0.342	negative regulation of macromolecule metabolic process
GO:0045934	0.308	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.300	negative regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.995	intracellular anatomical structure
GO:0005634	0.994	nucleus
GO:0032991	0.978	protein-containing complex
GO:0005667	0.690	transcription regulator complex
GO:0031981	0.427	nuclear lumen
GO:0005654	0.387	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]