StarFunc result for job id Q7Z6Z7

User Input

>input (1400 residues)
MKVDRTKLKKTPTEAPADCRALIDKLKVCNDEQLLLELQQIKTWNIGKCELYHWVDLLDR
FDGILADAGQTVENMSWMLVCDRPEREQLKMLLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASSDMQVVLAVLNLLYVFSKRSNYITRLGSDKRTPLLTRLQHLAESWGGKENGFGLA
ECCRDLHMMKYPPSATTLHFEFYADPGAEVKIEKRTTSNTLHYIHIEQLDKISESPSEIM
ESLTKMYSIPKDKQMLLFTHIRLAHGFSNHRKRLQAVQARLHAISILVYSNALQESANSI
LYNGLIEELVDVLQITDKQLMEIKAASLRTLTSIVHLERTPKLSSIIDCTGTASYHGFLP
VLVRNCIQAMIDPSMDPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLG
DEQDQITFVTRAVRVVDLITNLDMAAFQSHSGLSIFIYRLEHEVDLCRKECPFVIKPKIQ
RPNTTQEGEEMETDMDGVQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVMDGSLPTSL
KHIISNAEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATREV
LGSLPNVFSALCLNARGLQSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNLG
SAVDELMRHQPTLKTDATTAIIKLLEEICNLGRDPKYICQKPSIQKADGTATAPPPRSNH
AAEEASSEDEEEEEVQAMQSFNSTQQNETEPNQQVVGTEERIPIPLMDYILNVMKFVESI
LSNNTTDDHCQEFVNQKGLLPLVTILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPKV
LQEGLLQLDSILSSLEPLHRPIESPGGSVLLRELACAGNVADATLSAQATPLLHALTAAH
AYIMMFVHTCRVGQSEIRSISVNQWGSQLGLSVLSKLSQLYCSLVWESTVLLSLCTPNSL
PSGCEFGQADMQKLVPKDEKAGTTQGGKRSDGEQDGAAGSMDASTQGLLEGIGLDGDTLA
PMETDEPTASDSKGKSKITPAMAARIKQIKPLLSASSRLGRALAELFGLLVKLCVGSPVR
QRRSHHAASTTTAPTPAARSTASALTKLLTKGLSWQPPPYTPTPRFRLTFFICSVGFTSP
MLFDERKYPYHLMLQKFLCSGGHNALFETFNWALSMGGKVPVSEGLEHSDLPDGTGEFLD
AWLMLVEKMVNPTTVLESPHSLPAKLPGGVQNFPQFSALRFLVVTQKAAFTCIKNLWNRK
PLKVYGGRMAESMLAILCHILRGEPVIRERLSKEKEGSRGEEDTGQEEGGSRREPQVNQQ
QLQQLMDMGFTREHAMEALLNTSTMEQATEYLLTHPPPIMGGVVRDLSMSEEDQMMRAIA
MSLGQDIPMDQRAESPEEVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7jq9A	0.714	0.415	5.371E-97	2427	0.734	0.424	7jq9A.pdb.gz
2	PDB:7mopA	0.713	0.412	6.880E-97	2445	0.741	0.424	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
3	PDB:7r5jB0	0.196	0.165	2.909E-7	1748	0.099	0.079	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
4	AFDB:Q54BR4	0.123	0.109	6.210E-7	1784	0.117	0.092	Q54BR4.pdb.gz	Q54BR4_DICDI Fanconi anemia group I protein homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293476 PE=4 SV=1
5	PDB:7mqaSP	0.156	0.107	1.078E-6	2485	0.099	0.056	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	AFDB:Q5EBP3	0.168	0.239	1.094E-6	926	0.098	0.148	Q5EBP3.pdb.gz	ARMC5_MOUSE Armadillo repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Armc5 PE=2 SV=1
7	PDB:7r5jC0	0.109	0.096	1.898E-6	2011	0.121	0.084	7r5jC0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
8	PDB:6n1zA	0.256	0.348	3.116E-6	961	0.087	0.127	6n1zA.pdb.gz
9	PDB:7vf2A	0.157	0.174	5.892E-6	1196	0.109	0.127	7vf2A.pdb.gz
10	PDB:6vaeA	0.120	0.133	6.552E-6	1198	0.124	0.144	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
11	PDB:3gjxA	0.175	0.214	1.075E-5	1041	0.099	0.134	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
12	PDB:6xu2A	0.188	0.224	1.075E-5	1091	0.114	0.146	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
13	AFDB:J3KQ26	0.163	0.211	1.449E-5	1030	0.119	0.161	J3KQ26.pdb.gz	J3KQ26_HUMAN Armadillo repeat containing 5 OS=Homo sapiens OX=9606 GN=ARMC5 PE=1 SV=1
14	AFDB:G5EAZ4	0.188	0.275	2.139E-5	872	0.088	0.141	G5EAZ4.pdb.gz	G5EAZ4_EMENI Importin N-terminal domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00906 PE=4 SV=1
15	AFDB:E7FCG1	0.136	0.114	2.553E-5	1846	0.139	0.105	E7FCG1.pdb.gz	E7FCG1_DANRE ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) OS=Danio rerio OX=7955 GN=arfgef2 PE=1 SV=1
16	AFDB:Q6WWW4	0.205	0.161	2.941E-5	1888	0.109	0.081	Q6WWW4.pdb.gz	UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana OX=3702 GN=UPL3 PE=1 SV=1
17	AFDB:F4J246	0.136	0.135	3.157E-5	1415	0.116	0.115	F4J246.pdb.gz	F4J246_ARATH Condensin-1 complex subunit CAP-D2 OS=Arabidopsis thaliana OX=3702 GN=At3g57060 PE=1 SV=1
18	AFDB:Q38FR1	0.181	0.216	3.903E-5	1088	0.104	0.134	Q38FR1.pdb.gz	Q38FR1_TRYB2 Importin N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1250 PE=3 SV=1
19	AFDB:F4IXW2	0.101	0.084	4.827E-5	1739	0.123	0.099	F4IXW2.pdb.gz	BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana OX=3702 GN=BIG5 PE=1 SV=2
20	AFDB:P60330	0.168	0.126	5.181E-5	2118	0.128	0.085	P60330.pdb.gz	ESPL1_MOUSE Separin OS=Mus musculus OX=10090 GN=Espl1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P51593	0.0	1035	4454	0.351	0.110	HUWE1_RAT E3 ubiquitin-protein ligase HUWE1 OS=Rattus norvegicus OX=10116 GN=Huwe1 PE=1 SV=3
2	Q7TMY8	0.0	2892	4377	0.989	0.316	HUWE1_MOUSE E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus OX=10090 GN=Huwe1 PE=1 SV=5
3	Q7Z6Z7	0.0	2921	4374	1.000	0.320	HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3
4	X2JKH9	8.59e-119	415	5127	0.177	0.048	X2JKH9_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
5	X2JDY2	8.66e-119	415	5116	0.177	0.048	X2JDY2_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
6	X2JF83	9.74e-119	415	5101	0.177	0.049	X2JF83_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
7	Q9VXR3	1.10e-118	414	5146	0.177	0.048	Q9VXR3_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=2
8	X2JF73	1.15e-118	414	5151	0.177	0.048	X2JF73_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
9	X2JC16	1.19e-118	414	5150	0.177	0.048	X2JC16_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
10	X2JFK0	1.23e-118	414	5145	0.177	0.048	X2JFK0_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
11	Q9GUP2	2.45e-113	398	4177	0.261	0.088	Q9GUP2_CAEEL HECT-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=eel-1 PE=1 SV=2
12	U4PBY0	1.64e-112	395	4185	0.259	0.087	U4PBY0_CAEEL HECT-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=eel-1 PE=1 SV=1
13	Q8H0T4	8.25e-56	217	3658	0.166	0.064	UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana OX=3702 GN=UPL2 PE=1 SV=3
14	O13834	4.55e-37	155	3227	0.114	0.050	PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr1 PE=1 SV=1
15	Q03280	8.76e-22	105	3268	0.116	0.050	TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOM1 PE=1 SV=1
16	Q8GY23	0.005	43.9	3681	0.068	0.026	UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana OX=3702 GN=UPL1 PE=1 SV=3
17	Q8NBM4	0.045	40.0	344	0.015	0.061	UBAC2_HUMAN Ubiquitin-associated domain-containing protein 2 OS=Homo sapiens OX=9606 GN=UBAC2 PE=1 SV=1
18	Q8L6Y1	0.22	38.5	797	0.016	0.029	UBP14_ARATH Ubiquitin carboxyl-terminal hydrolase 14 OS=Arabidopsis thaliana OX=3702 GN=UBP14 PE=1 SV=1
19	Q8R1K1	0.29	37.7	345	0.017	0.070	UBAC2_MOUSE Ubiquitin-associated domain-containing protein 2 OS=Mus musculus OX=10090 GN=Ubac2 PE=1 SV=1
20	P31116	0.62	36.6	359	0.024	0.095	DHOM_YEAST Homoserine dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOM6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15700 DUF4667	2.7e+02	13.1	Domain of unknown function (DUF4667)
2	PF06012 DUF908	1.8e-24	98.5	Domain of Unknown Function (DUF908)
3	PF06025 DUF913	4.9e-105	363.3	Domain of Unknown Function (DUF913)
4	PF00627 UBA	0.00016	32.7	UBA/TS-N domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000340648

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358022	0.998	Induced myeloid leukemia cell differentiation protein Mcl-1
2	9606.ENSP00000418915	0.987	Cyclin-dependent kinase inhibitor 2A
3	9606.ENSP00000479618	0.985	Myc proto-oncogene protein
4	9606.ENSP00000441543	0.979	Polyubiquitin-C
5	9606.ENSP00000400906	0.946	Ubiquitin-conjugating enzyme E2L 3
6	9606.ENSP00000168216	0.942	3-hydroxyacyl-CoA dehydrogenase type-2
7	9606.ENSP00000363019	0.932	Ubiquitin-conjugating enzyme E2 D1
8	9606.ENSP00000381717	0.928	Ubiquitin-conjugating enzyme E2 D2
9	9606.ENSP00000304697	0.912	Polyubiquitin-B
10	9606.ENSP00000351490	0.909	Protein max
11	9606.ENSP00000343535	0.893	Ubiquitin carboxyl-terminal hydrolase 7
12	9606.ENSP00000352925	0.891	Transformation/transcription domain-associated protein
13	9606.ENSP00000316357	0.889	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
14	9606.ENSP00000388107	0.857	Ubiquitin-60S ribosomal protein L40
15	9606.ENSP00000269305	0.855	Cellular tumor antigen p53
16	9606.ENSP00000272317	0.849	Ubiquitin-40S ribosomal protein S27a
17	9606.ENSP00000358674	0.842	Ubiquitin-like protein 4A
18	9606.ENSP00000297540	0.835	Phosphorylated adapter RNA export protein
19	9606.ENSP00000460348	0.792	Pre-mRNA-processing-splicing factor 8
20	9606.ENSP00000288828	0.786	WD repeat domain phosphoinositide-interacting protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	1.000	nucleic acid binding
GO:0061630	0.997	ubiquitin protein ligase activity
GO:0003723	0.992	RNA binding
GO:0003677	0.358	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031398	0.990	positive regulation of protein ubiquitination
GO:0048511	0.972	rhythmic process
GO:0007623	0.925	circadian rhythm
GO:0032922	0.913	circadian regulation of gene expression
GO:0009987	0.430	cellular process
GO:0050794	0.402	regulation of cellular process
GO:0071704	0.302	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol
GO:0016020	0.483	membrane
GO:0012505	0.454	endomembrane system
GO:0031982	0.390	vesicle
GO:0005576	0.389	extracellular region
GO:0031410	0.381	cytoplasmic vesicle
GO:0070062	0.378	extracellular exosome
GO:0034774	0.374	secretory granule lumen
GO:1904813	0.368	ficolin-1-rich granule lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]