StarFunc result for job id Q7Z739

User Input

>input (585 residues)
MSATSVDQRPKGQGNKVSVQNGSIHQKDAVNDDDFEPYLSSQTNQSNSYPPMSDPYMPSY
YAPSIGFPYSLGEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLG
QHGFNFFPGNADFSTWGTSGSQGQSTQSSAYSSSYGYPPSSLGRAITDGQAGFGNDTLSK
VPGISSIEQGMTGLKIGGDLTAAVTKTVGTALSSSGMTSIATNSVPPVSSAAPKPTSWAA
IARKPAKPQPKLKPKGNVGIGGSAVPPPPIKHNMNIGTWDEKGSVVKAPPTQPVLPPQTI
IQQPQPLIQPPPLVQSQLPQQQPQPPQPQQQQGPQPQAQPHQVQPQQQQLQNRWVAPRNR
GAGFNQNNGAGSENFGLGVVPVSASPSSVEVHPVLEKLKAINNYNPKDFDWNLKNGRVFI
IKSYSEDDIHRSIKYSIWCSTEHGNKRLDAAYRSLNGKGPLYLLFSVNGSGHFCGVAEMK
SVVDYNAYAGVWSQDKWKGKFEVKWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPL
EKAKQVLKIIATFKHTTSIFDDFAHYEKRQEEEEAMRRERNRNKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B4DPX9	0.366	0.365	2.930E-80	588	0.969	0.964	B4DPX9.pdb.gz	B4DPX9_HUMAN YTH domain-containing family protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q91YT7	0.367	0.371	1.105E-62	579	0.682	0.689	Q91YT7.pdb.gz	YTHD2_MOUSE YTH domain-containing family protein 2 OS=Mus musculus OX=10090 GN=Ythdf2 PE=1 SV=1
3	AFDB:E7F1H9	0.384	0.369	2.113E-58	613	0.655	0.625	E7F1H9.pdb.gz	YTHD2_DANRE YTH domain-containing family protein 2 OS=Danio rerio OX=7955 GN=ythdf2 PE=1 SV=1
4	AFDB:Q802Z0	0.391	0.374	1.312E-57	614	0.650	0.619	Q802Z0.pdb.gz	Q802Z0_DANRE YTH domain-containing family protein OS=Danio rerio OX=7955 GN=fb49c02 PE=1 SV=1
5	AFDB:F4I0C2	0.310	0.303	3.129E-25	599	0.279	0.272	F4I0C2.pdb.gz	F4I0C2_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT4 PE=1 SV=1
6	AFDB:Q9LJE5	0.330	0.292	8.285E-25	667	0.280	0.246	Q9LJE5.pdb.gz	ECT2_ARATH YTH domain-containing protein ECT2 OS=Arabidopsis thaliana OX=3702 GN=ECT2 PE=1 SV=1
7	PDB:5j3eA	0.171	0.492	1.500E-2	172	0.039	0.134	5j3eA.pdb.gz	Crystal Structure of Human THYN1 protein in complex with 5-methylcytosine containing DNA
8	AFDB:Q8CH19	0.084	0.071	8.696E-2	720	0.147	0.119	Q8CH19.pdb.gz	CS2IP_MOUSE Casein kinase II subunit alpha'-interacting protein OS=Mus musculus OX=10090 GN=Csnka2ip PE=1 SV=2
9	PDB:7mq8SM	0.047	0.080	3.342E-1	290	0.022	0.045	7mq8SM.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:1gsaA	0.082	0.131	5.438E-1	314	0.015	0.029	1gsaA.pdb.gz	A pseudo-michaelis quaternary complex in the reverse reaction of a ligase: structure of Escherichia coli B glutathione synthetase complexed with ADP, glutathione, and sulfate at 2.0 A resolution.
11	PDB:1gshA	0.073	0.123	5.438E-1	296	0.015	0.030	1gshA.pdb.gz
12	PDB:2hqsA	0.069	0.091	8.327E-1	412	0.019	0.027	2hqsA.pdb.gz
13	AFDB:Q94546	0.064	0.056	1.191	725	0.147	0.119	Q94546.pdb.gz	ATU_DROME Another transcription unit protein OS=Drosophila melanogaster OX=7227 GN=Atu PE=1 SV=2
14	PDB:7nacA	0.045	0.086	1.200	266	0.038	0.083	7nacA.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
15	PDB:1ydwB	0.068	0.098	1.275	350	0.041	0.069	1ydwB.pdb.gz
16	AFDB:Q63HR2	0.073	0.040	1.345	1409	0.157	0.065	Q63HR2.pdb.gz	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
17	PDB:6cesD	0.058	0.040	1.530	901	0.024	0.016	6cesD.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
18	PDB:2ljkA	0.056	0.183	1.626	117	0.027	0.137	2ljkA.pdb.gz
19	PDB:1k8kD	0.066	0.105	1.728	284	0.029	0.060	1k8kD.pdb.gz
20	AFDB:Q9HFF4	0.068	0.049	1.823	1023	0.149	0.085	Q9HFF4.pdb.gz	PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DPX9	0.0	1165	588	0.969	0.964	B4DPX9_HUMAN YTH domain-containing family protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	E7F1H9	0.0	673	613	0.648	0.618	YTHD2_DANRE YTH domain-containing family protein 2 OS=Danio rerio OX=7955 GN=ythdf2 PE=1 SV=1
3	P59326	0.0	735	559	0.682	0.714	YTHD1_MOUSE YTH domain-containing family protein 1 OS=Mus musculus OX=10090 GN=Ythdf1 PE=1 SV=1
4	Q7Z739	0.0	1199	585	1.000	1.000	YTHD3_HUMAN YTH domain-containing family protein 3 OS=Homo sapiens OX=9606 GN=YTHDF3 PE=1 SV=1
5	Q8BYK6	0.0	1186	585	0.988	0.988	YTHD3_MOUSE YTH domain-containing family protein 3 OS=Mus musculus OX=10090 GN=Ythdf3 PE=1 SV=2
6	Q91YT7	0.0	752	579	0.687	0.694	YTHD2_MOUSE YTH domain-containing family protein 2 OS=Mus musculus OX=10090 GN=Ythdf2 PE=1 SV=1
7	Q9BYJ9	0.0	742	559	0.687	0.719	YTHD1_HUMAN YTH domain-containing family protein 1 OS=Homo sapiens OX=9606 GN=YTHDF1 PE=1 SV=1
8	Q9Y5A9	0.0	751	579	0.689	0.696	YTHD2_HUMAN YTH domain-containing family protein 2 OS=Homo sapiens OX=9606 GN=YTHDF2 PE=1 SV=2
9	Q802Z0	6.59e-120	369	614	0.306	0.292	Q802Z0_DANRE YTH domain-containing family protein OS=Danio rerio OX=7955 GN=fb49c02 PE=1 SV=1
10	Q9VBZ5	2.52e-80	268	700	0.221	0.184	YTHDF_DROME YTH domain-containing family protein OS=Drosophila melanogaster OX=7227 GN=Ythdf PE=1 SV=1
11	Q0WR25	8.27e-61	214	634	0.173	0.159	Q0WR25_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT5 PE=1 SV=1
12	F4KDJ9	2.32e-59	208	528	0.161	0.178	F4KDJ9_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT10 PE=1 SV=1
13	F4K1Z0	5.09e-59	206	495	0.186	0.220	ECT3_ARATH YTH domain-containing protein ECT3 OS=Arabidopsis thaliana OX=3702 GN=ECT3 PE=1 SV=1
14	Q9FPE7	7.60e-57	201	528	0.168	0.186	Q9FPE7_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT8 PE=1 SV=1
15	F4HWS5	1.89e-56	202	639	0.161	0.147	F4HWS5_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT7 PE=1 SV=1
16	Q9LJE5	2.41e-56	203	667	0.162	0.142	ECT2_ARATH YTH domain-containing protein ECT2 OS=Arabidopsis thaliana OX=3702 GN=ECT2 PE=1 SV=1
17	F4I0C2	7.74e-56	200	599	0.162	0.159	F4I0C2_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT4 PE=1 SV=1
18	Q1JPL5	4.29e-55	198	595	0.159	0.156	Q1JPL5_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT6 PE=1 SV=1
19	Q3MK94	6.33e-52	186	428	0.154	0.210	ECT1_ARATH YTH domain-containing protein ECT1 OS=Arabidopsis thaliana OX=3702 GN=ECT1 PE=1 SV=1
20	Q56XH8	5.31e-50	181	470	0.145	0.181	Q56XH8_ARATH YTH domain-containing family protein OS=Arabidopsis thaliana OX=3702 GN=ECT11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03153 TFIIA	1.4e+02	13.9	Transcription factor IIA, alpha/beta subunit
2	PF04146 YTH	1.1e-36	138.3	YT521-B-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000010417

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000012532	0.850	Methyltransferase like 3
2	60711.ENSCSAP00000000132	0.824	Methyltransferase like 14
3	60711.ENSCSAP00000004439	0.816	AlkB family member 5, RNA demethylase
4	60711.ENSCSAP00000000456	0.812	Zinc finger, C3H1-type containing
5	60711.ENSCSAP00000008773	0.781	Wilms tumor 1 associated protein
6	60711.ENSCSAP00000001611	0.772	FTO, alpha-ketoglutarate dependent dioxygenase
7	60711.ENSCSAP00000000921	0.720	Eukaryotic translation initiation factor 4 gamma, 2
8	60711.ENSCSAP00000017218	0.634	Exosome component 10
9	60711.ENSCSAP00000008839	0.581	Vir like m6A methyltransferase associated
10	60711.ENSCSAP00000005325	0.560	Zinc finger CCCH-type containing 3
11	60711.ENSCSAP00000014461	0.555	Meiosis specific with coiled-coil domain
12	60711.ENSCSAP00000001053	0.548	CCR4-NOT transcription complex, subunit 1
13	60711.ENSCSAP00000016463	0.536	RNA binding motif protein 15
14	60711.ENSCSAP00000012450	0.535	Ski2 like RNA helicase 2
15	60711.ENSCSAP00000014014	0.535	Serrate, RNA effector molecule
16	60711.ENSCSAP00000014888	0.535	DExD/H-box helicase 60
17	60711.ENSCSAP00000009914	0.509	RNA N6-methyltransferase that methylates adenosine residues of a subset of RNAs and plays a key role in S-adenosyl-L-methionine homeostasis by regulating expression of MAT2A transcripts. Able to N6- methylate a subset of mRNAs and U6 small nuclear RNAs (U6 snRNAs). In contrast to the METTL3-METTL14 heterodimer, only able to methylate a limited number of RNAs: requires both a 5'UACAGAGAA-3' nonamer sequence and a specific RNA structure. In presence of S-adenosyl-L-methionine, binds the 3'-UTR region of MAT2A mRNA and specifically N6-methylates the first hairpin of MAT2A mRNA, impairing [...]
18	60711.ENSCSAP00000008490	0.503	Vacuolar protein sorting 13 homolog B (yeast)
19	60711.ENSCSAP00000008455	0.500	annotation not available
20	60711.ENSCSAP00000013592	0.500	RNA binding motif protein 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990247	1.000	N6-methyladenosine-containing RNA binding
GO:0043021	0.750	ribonucleoprotein complex binding
GO:0003729	0.702	mRNA binding
GO:0043022	0.683	ribosome binding
GO:0005515	0.558	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0006417	0.989	regulation of translation
GO:0009894	0.956	regulation of catabolic process
GO:0031331	0.953	positive regulation of cellular catabolic process
GO:0017148	0.953	negative regulation of translation
GO:0061013	0.950	regulation of mRNA catabolic process
GO:0010604	0.947	positive regulation of macromolecule metabolic process
GO:0061014	0.944	positive regulation of mRNA catabolic process
GO:0043488	0.943	regulation of mRNA stability
GO:0061157	0.933	mRNA destabilization
GO:0006446	0.833	regulation of translational initiation
GO:0009987	0.524	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0043229	0.952	intracellular organelle
GO:0043232	0.744	intracellular non-membrane-bounded organelle
GO:0005829	0.575	cytosol
GO:0032991	0.549	protein-containing complex
GO:0070013	0.525	intracellular organelle lumen
GO:0031981	0.521	nuclear lumen
GO:0005654	0.496	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]