StarFunc result for job id Q7Z745

User Input

>input (1585 residues)
MTLSTEESIEMFGDINLTLGMLNKEDIVNKEDIYSHLTSVIQNTDILDDAIVQRLIYYAS
KDMRDNNMLREIRMLAGEVLVSLAAHDFNSVMYEVQSNFRILELPDEFVVLALAELATSY
VSQSIPFMMMTLLTMQTMLRLAEDERMKGTFCIALEKFSKAIYKYVNHWRDFPYPRLDAN
RLSDKIFMLFWYIMEKWAPLASPMQTLSIVKAHGPTVSLLLHREDFRGYALGQVPWLLNQ
YKDKEIDFHVTQSLKQILTAAVLYDIGLPRSLRRSIFINLLQQICRAPEPPVKENEMKAS
SCFLILAHSNPGELMEFFDEQVRSNNEAIRVGILTLLRLAVNADEPRLRDHIISIERTVK
IVMGDLSTKVRNSVLLLIQTMCEKSYIEAREGWPLIDYVFSQFATLNRNLEKPVKTNFHE
NEKEEESVRETSLEVLKTLDPLVIGMPQVLWPRILTFVVPAEYTEALEPLFSIIRILIMA
EEKKQHSAKESTALVVSTGAVKLPSPQQLLARLLVISMPASLGELRGAGAIGLLKILPEI
IHPKLVDLWKTRLPELLQPLEGKNISTVLWETMLLQLLKESLWKISDVAWTIQLTQDFKQ
QMGSYSNNSTEKKFLWKALGTTLACCQDSDFVNSQIKEFLTAPNQLGDQRQGITSILGYC
AENHLDIVLKVLKTFQNQEKFFMNRCKSLFSGKKSLTKTDVMVIYGAVALHAPKKQLLSR
LNQDIISQVLSLHGQCSQVLGMSVMNKDMDLQMSFTRSITEIGIAVQDAEDQGFQFSYKE
MLIGYMLDFIRDEPLDSLASPIRWKALIAIRYLSKLKPQLSLQDHLNILEENIRRLLPLP
PLENLKSEGQTDKDKEHIQFLYERSMDALGKLLKTMMWDNVNAEDCQEMFNLLQMWLVSQ
KEWERERAFQITAKVLTNDIEAPENFKIGSLLGLLAPHSCDTLPTIRQAAASSTIGLFYI
KGIHLEVERLQGLQEGLESDDVQVQIKISSKIAKIVSKFIPNEEILMFLEEMLDGLESLN
PTCTKACGIWMITVLKQQGAALEDQLLEILGTIYHHMPVLRQKEESFQFILEAISQIASF
HMDTVVVNLLQKPLPFDRDTKTLWKALAEKPASSGKLLQALIDKLETELEDDIARVEAIS
VACAMYEVISMGTSVTGLYPELFTLLLKLVSCTLGQKMLTCPWSHRRHVMQQGEQQQIPD
PCRLSTATLKCLQAQAMREGLAKESDEGDNLWTLLSSPSTHHIGVCSLARSMAVWQHGVI
LDIMEQLLSSLTSSSENYRITGAAFFSELMKEPILWKHGNLRNVLILMDQSAWDSNATLR
QMAIRGLGNTASGAPHKVKKHKQLMLESIIRGLYHLARTEVVCESLKALKKILELLTDRD
VSFYFKEIVLQTRTFFEDEQDDVRLTAIFLFEDLAPLTGRRWKIFFAEEIKKSLISFLLH
LWDPNPKIGVACRDVLMVCIPFLGLQELYGVLDRLLDQDLPRARDFYRQFCVKLAKKNQE
ILWILHTHSFTFFTSTWEVIRSAAVKLTDAVVLNLTSQYVELLDREQLTTRLQALRQDPC
ISVQRAAEAALQTLLRRCKETSIPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7M6Y6	0.957	0.959	0.000	1581	0.813	0.815	Q7M6Y6.pdb.gz	MRO2B_MOUSE Maestro heat-like repeat-containing protein family member 2B OS=Mus musculus OX=10090 GN=Mroh2b PE=1 SV=2
2	AFDB:Q54F23	0.513	0.495	1.137E-46	1647	0.213	0.205	Q54F23.pdb.gz	MROH1_DICDI Maestro heat-like repeat-containing protein family member 1 OS=Dictyostelium discoideum OX=44689 GN=mroh1 PE=4 SV=1
3	AFDB:Q9W350	0.464	0.428	8.109E-39	1742	0.181	0.165	Q9W350.pdb.gz	Q9W350_DROME C11.1, isoform A OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=1 SV=2
4	AFDB:F4IP13	0.473	0.442	2.133E-36	1716	0.192	0.177	F4IP13.pdb.gz	SHGR6_ARATH Protein SHOOT GRAVITROPISM 6 OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=2 SV=1
5	AFDB:G3X8W1	0.308	0.469	1.405E-24	983	0.127	0.204	G3X8W1.pdb.gz	G3X8W1_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
6	AFDB:Q68CQ1	0.337	0.390	2.884E-24	1323	0.120	0.144	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
7	AFDB:F4I893	0.130	0.091	6.723E-15	2696	0.139	0.082	F4I893.pdb.gz	ILA_ARATH Protein ILITYHIA OS=Arabidopsis thaliana OX=3702 GN=ILA PE=1 SV=1
8	AFDB:Q5VYK3	0.182	0.166	1.430E-14	1845	0.133	0.114	Q5VYK3.pdb.gz	ECM29_HUMAN Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2
9	AFDB:F4I718	0.192	0.159	1.652E-14	2136	0.144	0.107	F4I718.pdb.gz	CSI3_ARATH Protein CELLULOSE SYNTHASE INTERACTIVE 3 OS=Arabidopsis thaliana OX=3702 GN=CSI3 PE=1 SV=1
10	AFDB:E9PVA8	0.118	0.083	1.712E-14	2671	0.167	0.099	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
11	PDB:7mp6B	0.274	0.271	2.532E-14	1609	0.135	0.133	7mp6B.pdb.gz
12	PDB:7pgsN	0.313	0.285	5.388E-14	1787	0.141	0.125	7pgsN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
13	PDB:7mqaLM	0.227	0.198	7.972E-12	2041	0.151	0.118	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mqaSP	0.132	0.103	6.649E-11	2485	0.143	0.091	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6yejA	0.168	0.137	1.466E-10	2046	0.146	0.113	6yejA.pdb.gz
16	PDB:7r04B	0.254	0.195	1.633E-10	2229	0.142	0.101	7r04B.pdb.gz	Structural basis of activation of the tumor suppressor protein neurofibromin.
17	PDB:4a0cA	0.145	0.188	2.101E-10	1155	0.108	0.148	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
18	PDB:7mq8LM	0.213	0.184	3.602E-10	2005	0.141	0.111	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7unkA	0.145	0.198	3.870E-10	1047	0.117	0.177	7unkA.pdb.gz
20	PDB:7pgrN	0.258	0.187	5.160E-10	2423	0.143	0.094	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7M6Y6	0.0	2668	1581	0.814	0.816	MRO2B_MOUSE Maestro heat-like repeat-containing protein family member 2B OS=Mus musculus OX=10090 GN=Mroh2b PE=1 SV=2
2	Q54F23	1.22e-61	236	1647	0.220	0.211	MROH1_DICDI Maestro heat-like repeat-containing protein family member 1 OS=Dictyostelium discoideum OX=44689 GN=mroh1 PE=4 SV=1
3	Q7TNB4	9.24e-37	142	248	0.049	0.315	MSTRO_MOUSE Protein maestro OS=Mus musculus OX=10090 GN=Mro PE=2 SV=1
4	Q68CQ1	5.79e-29	129	1323	0.127	0.152	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
5	Q9DA96	5.21e-23	109	983	0.134	0.216	Q9DA96_MOUSE Maestro heat-like repeat family member 5 OS=Mus musculus OX=10090 GN=Mroh4 PE=2 SV=1
6	G3X8W1	8.26e-23	108	983	0.134	0.216	G3X8W1_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
7	Q14DS2	3.94e-22	106	914	0.117	0.204	Q14DS2_MOUSE 1700016M24Rik protein OS=Mus musculus OX=10090 GN=Mroh4 PE=2 SV=1
8	E9PZ22	4.44e-22	106	914	0.117	0.204	E9PZ22_MOUSE Maestro heat-like repeat family member 4 OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
9	F4IP13	2.48e-21	104	1716	0.110	0.102	SHGR6_ARATH Protein SHOOT GRAVITROPISM 6 OS=Arabidopsis thaliana OX=3702 GN=SGR6 PE=2 SV=1
10	Q9W350	6.73e-15	83.2	1742	0.093	0.084	Q9W350_DROME C11.1, isoform A OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=1 SV=2
11	A0A5F8MPT5	2.15e-13	76.3	385	0.051	0.210	A0A5F8MPT5_MOUSE Maestro heat-like repeat family member 4 (Fragment) OS=Mus musculus OX=10090 GN=Mroh4 PE=1 SV=1
12	Q9NHY0	2.17e-07	58.5	1407	0.088	0.100	Q9NHY0_DROME C11.1 (Fragment) OS=Drosophila melanogaster OX=7227 GN=c11.1 PE=4 SV=1
13	F2XF92	3.2	35.0	874	0.019	0.034	ISOPS_PICSI Isopimaradiene synthase, chloroplastic OS=Picea sitchensis OX=3332 GN=TPS-Iso PE=1 SV=1
14	E9QHI1	4.0	34.7	1720	0.017	0.016	E9QHI1_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
15	F1QYE2	4.3	34.7	1811	0.017	0.015	F1QYE2_DANRE Tenascin C OS=Danio rerio OX=7955 GN=tenc PE=1 SV=1
16	Q9NY15	8.7	33.5	2570	0.012	0.007	STAB1_HUMAN Stabilin-1 OS=Homo sapiens OX=9606 GN=STAB1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08740 BCS1_N	1.9e+02	13.4	BCS1 N terminal
2	PF02985 HEAT	14	17.3	HEAT repeat
3	PF13513 HEAT_EZ	74	15.3	HEAT-like repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382476

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306157	0.647	Interleukin-7 receptor subunit alpha
2	9606.ENSP00000334974	0.626	UPF0524 protein C3orf70
3	9606.ENSP00000290158	0.591	Importin subunit beta-1
4	9606.ENSP00000326718	0.534	Olfactory receptor 10A7
5	9606.ENSP00000417914	0.508	Ankyrin repeat and SOCS box protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0007165	0.988	signal transduction
GO:0035556	0.960	intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031982	0.998	vesicle
GO:0030141	0.991	secretory granule
GO:0031514	0.985	motile cilium
GO:0097729	0.984	9+2 motile cilium
GO:0016020	0.961	membrane
GO:0036126	0.959	sperm flagellum
GO:0001669	0.936	acrosomal vesicle
GO:0097225	0.931	sperm midpiece
GO:0031090	0.618	organelle membrane
GO:0032991	0.507	protein-containing complex
GO:0005829	0.433	cytosol
GO:0070013	0.312	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]