StarFunc result for job id Q7Z794

User Input

>input (578 residues)
MSHQFSSQSAFSSMSRRVYSTSSSAGSGGGSPAVGSVCYARGRCGGGGYGIHGRGFGSRS
LYNLGGSRSISINLMGRSTSGFCQGGGVGGFGGGRGFGVGSTGAGGFGGGGFGGAGFGTS
NFGLGGFGPYCPPGGIQEVTINQSLLEPLHLEVDPEIQRIKTQEREQIMVLNNKFASFID
KVRFLEQQNQVLQTKWELLQQVNTSTGTNNLEPLLENYIGDLRRQVDLLSAEQMRQNAEV
RSMQDVVEDYKSKYEDEINKRTGSENDFVVLKKDVDAAYVSKVDLESRVDTLTGEVNFLK
YLFLTELSQVQTHISDTNVILSMDNNRSLDLDSIIDAVRTQYELIAQRSKDEAEALYQTK
YQELQITAGRHGDDLKNSKMEIAELNRTVQRLQAEISNVKKQIEQMQSLISDAEERGEQA
LQDAWQKLQDLEEALQQSKEELARLLRDYQAMLGVKLSLDVEIATYRQLLEGEESRMSGE
LQSHVSISVQNSQVSVNGGAGGGGSYGSGGYGGGSGGGYGGGRSYRGGGARGRSGGGYGS
GCGGGGGSYGGSGRSGRGSSRVQIIQTSTNTSHRRILE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0IIN1	0.320	0.320	1.442E-64	578	0.998	0.998	Q0IIN1.pdb.gz	Q0IIN1_HUMAN Keratin 77 OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=1
2	AFDB:Q6IFZ6	0.458	0.462	1.090E-43	572	0.739	0.747	Q6IFZ6.pdb.gz	K2C1B_MOUSE Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1
3	AFDB:Q5XKE5	0.357	0.381	1.686E-32	535	0.547	0.591	Q5XKE5.pdb.gz	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
4	AFDB:P02538	0.283	0.290	2.417E-32	564	0.566	0.580	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
5	AFDB:P04264	0.291	0.263	4.619E-32	644	0.631	0.567	P04264.pdb.gz	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
6	AFDB:Q9Z331	0.272	0.279	6.619E-32	562	0.545	0.560	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
7	AFDB:Q922U2	0.280	0.279	7.644E-32	580	0.569	0.567	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
8	AFDB:P13647	0.280	0.274	1.019E-31	590	0.588	0.576	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
9	AFDB:P19013	0.421	0.458	1.095E-31	520	0.554	0.615	P19013.pdb.gz	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
10	AFDB:P07744	0.330	0.357	1.177E-31	525	0.545	0.600	P07744.pdb.gz	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
11	PDB:5wlcST	0.097	0.095	8.294	599	0.035	0.033	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
12	PDB:6uxvG	0.087	0.205	8.294	197	0.038	0.112	6uxvG.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
13	PDB:5yfpA	0.066	0.060	8.912	672	0.036	0.031	5yfpA.pdb.gz
14	PDB:7d5sRN	0.099	0.095	8.912	607	0.038	0.036	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
15	PDB:7sqkE	0.144	0.138	8.912	610	0.116	0.110	7sqkE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O95678	0.0	550	551	0.493	0.517	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
2	P13647	0.0	526	590	0.505	0.495	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
3	P19013	0.0	540	520	0.497	0.552	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
4	Q0IIN1	0.0	1149	578	0.998	0.998	Q0IIN1_HUMAN Keratin 77 OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=1
5	Q3SY84	0.0	541	523	0.509	0.562	K2C71_HUMAN Keratin, type II cytoskeletal 71 OS=Homo sapiens OX=9606 GN=KRT71 PE=1 SV=3
6	Q5XKE5	0.0	546	535	0.502	0.542	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
7	Q6IFZ6	0.0	644	572	0.664	0.671	K2C1B_MOUSE Keratin, type II cytoskeletal 1b OS=Mus musculus OX=10090 GN=Krt77 PE=1 SV=1
8	Q7Z794	0.0	1152	578	1.000	1.000	K2C1B_HUMAN Keratin, type II cytoskeletal 1b OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=3
9	Q86Y46	0.0	556	540	0.538	0.576	K2C73_HUMAN Keratin, type II cytoskeletal 73 OS=Homo sapiens OX=9606 GN=KRT73 PE=1 SV=1
10	Q8BGZ7	0.0	524	551	0.491	0.515	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
11	Q9R0H5	0.0	538	524	0.517	0.571	K2C71_MOUSE Keratin, type II cytoskeletal 71 OS=Mus musculus OX=10090 GN=Krt71 PE=1 SV=1
12	Q9Z331	1.54e-180	523	562	0.491	0.505	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
13	P50446	1.93e-178	517	553	0.422	0.441	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
14	P04259	2.42e-178	517	564	0.476	0.488	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
15	P02538	3.75e-178	517	564	0.474	0.486	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
16	P48668	6.31e-178	516	564	0.471	0.482	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
17	Q14CN4	1.15e-177	513	511	0.462	0.523	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
18	Q7RTS7	2.32e-177	513	529	0.436	0.476	K2C74_HUMAN Keratin, type II cytoskeletal 74 OS=Homo sapiens OX=9606 GN=KRT74 PE=1 SV=2
19	P07744	6.55e-177	512	525	0.493	0.543	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
20	Q6P6Q2	4.52e-175	509	576	0.426	0.427	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13166 AAA_13	6.4e+02	10.4	AAA domain
2	PF11559 ADIP	9.6	17.8	Afadin- and alpha -actinin-Binding
3	PF11839 Alanine_zipper	2.1e+02	13.7	Alanine-zipper, major outer membrane lipoprotein
4	PF10473 CENP-F_leu_zip	51	15.3	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
5	PF00038 Filament	5.9e-96	333.3	Intermediate filament protein
6	PF05130 FlgN	55	15.7	FlgN protein
7	PF16208 Keratin_2_head	4.1e-41	152.3	Keratin type II head
8	PF16210 Keratin_2_tail	68	15.2	Keratin type II cytoskeletal 1 tail
9	PF16073 SAT	5.8e+02	11.5	Starter unit:ACP transacylase in aflatoxin biosynthesis

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342710

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310861	0.901	Keratin, type II cytoskeletal 2 epidermal
2	9606.ENSP00000252244	0.895	Keratin, type II cytoskeletal 1
3	9606.ENSP00000269576	0.869	Keratin, type I cytoskeletal 10
4	9606.ENSP00000357772	0.544	Late cornified envelope protein 2C
5	9606.ENSP00000257198	0.539	Desmocollin-1
6	9606.ENSP00000307240	0.532	Keratin, type II cytoskeletal 74
7	9606.ENSP00000257951	0.531	Keratin, type II cuticular Hb4
8	9606.ENSP00000257974	0.529	Keratin, type II cuticular Hb2
9	9606.ENSP00000267119	0.528	Keratin, type II cytoskeletal 71
10	9606.ENSP00000257901	0.523	Keratin, type II cuticular Hb5
11	9606.ENSP00000307014	0.523	Keratin, type II cytoskeletal 73
12	9606.ENSP00000252245	0.519	Keratin, type II cytoskeletal 75
13	9606.ENSP00000369349	0.519	Keratin, type II cuticular Hb1
14	9606.ENSP00000385592	0.517	Immunoglobulin superfamily member 23
15	9606.ENSP00000444533	0.514	Keratin, type II cuticular Hb6
16	9606.ENSP00000293745	0.510	Keratin, type II cytoskeletal 72
17	9606.ENSP00000293670	0.509	Keratin, type II cuticular Hb3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.593	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.981	cellular process
GO:0032502	0.727	developmental process
GO:0048856	0.695	anatomical structure development
GO:0065007	0.470	biological regulation
GO:0009888	0.467	tissue development
GO:0071840	0.435	cellular component organization or biogenesis
GO:0050789	0.428	regulation of biological process
GO:0016043	0.412	cellular component organization
GO:0043588	0.365	skin development
GO:0060429	0.325	epithelium development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0043227	0.996	membrane-bounded organelle
GO:0005576	0.984	extracellular region
GO:0031982	0.970	vesicle
GO:0043230	0.963	extracellular organelle
GO:0065010	0.953	extracellular membrane-bounded organelle
GO:0016020	0.922	membrane
GO:0005615	0.914	extracellular space
GO:0071944	0.904	cell periphery
GO:1903561	0.865	extracellular vesicle
GO:0070062	0.862	extracellular exosome
GO:0005856	0.804	cytoskeleton
GO:0005886	0.716	plasma membrane
GO:0045111	0.692	intermediate filament cytoskeleton
GO:0099512	0.662	supramolecular fiber
GO:0099513	0.630	polymeric cytoskeletal fiber
GO:0005882	0.525	intermediate filament
GO:0043231	0.407	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]