StarFunc result for job id Q7Z7A1

User Input

>input (2325 residues)
MKKGSQQKIFSKAKIPSSSHSPIPSSMSNMRSRSLSPLIGSETLPFHSGGQWCEQVEIAD
ENNMLLDYQDHKGADSHAGVRYITEALIKKLTKQDNLALIKSLNLSLSKDGGKKFKYIEN
LEKCVKLEVLNLSYNLIGKIEKLDKLLKLRELNLSYNKISKIEGIENMCNLQKLNLAGNE
IEHIPVWLGKKLKSLRVLNLKGNKISSLQDISKLKPLQDLISLILVENPVVTLPHYLQFT
IFHLRSLESLEGQPVTTQDRQEAFERFSLEEVERLERDLEKKMIETEELKSKQTRFLEEI
KNQDKLNKSLKEEAMLQKQSCEELKSDLNTKNELLKQKTIELTRACQKQYELEQELAFYK
IDAKFEPLNYYPSEYAEIDKAPDESPYIGKSRYKRNMFATESYIIDSAQAVQIKKMEPDE
QLRNDHMNLRGHTPLDTQLEDKEKKISAAQTRLSELHDEIEKAEQQILRATEEFKQLEEA
IQLKKISEAGKDLLYKQLSGRLQLVNKLRQEALDLELQMEKQKQEIAGKQKEIKDLQIAI
DSLDSKDPKHSHMKAQKSGKEQQLDIMNKQYQQLESRLDEILSRIAKETEEIKDLEEQLT
EGQIAANEALKKDLEGVISGLQEYLGTIKGQATQAQNECRKLRDEKETLLQRLTEVEQER
DQLEIVAMDAENMRKELAELESALQEQHEVNASLQQTQGDLSAYEAELEARLNLRDAEAN
QLKEELEKVTRLTQLEQSALQAELEKERQALKNALGKAQFSEEKEQENSELHAKLKHLQD
DNNLLKQQLKDFQNHLNHVVDGLVRPEEVAARVDELRRKLKLGTGEMNIHSPSDVLGKSL
ADLQKQFSEILARSKWERDEAQVRERKLQEEMALQQEKLATGQEEFRQACERALEARMNF
DKRQHEARIQQMENEIHYLQENLKSMEEIQGLTDLQLQEADEEKERILAQLRELEKKKKL
EDAKSQEQVFGLDKELKKLKKAVATSDKLATAELTIAKDQLKSLHGTVMKINQERAEELQ
EAERFSRKAAQAARDLTRAEAEIELLQNLLRQKGEQFRLEMEKTGVGTGANSQVLEIEKL
NETMERQRTEIARLQNVLDLTGSDNKGGFENVLEEIAELRREVSYQNDYISSMADPFKRR
GYWYFMPPPPSSKVSSHSSQATKDSGVGLKYSASTPVRKPRPGQQDGKEGSQPPPASGYW
VYSPIRSGLHKLFPSRDADSGGDSQEESELDDQEEPPFVPPPGYMMYTVLPDGSPVPQGM
ALYAPPPPLPNNSRPLTPGTVVYGPPPAGAPMVYGPPPPNFSIPFIPMGVLHCNVPEHHN
LENEVSRLEDIMQHLKSKKREERWMRASKRQSEKEMEELHHNIDDLLQEKKSLECEVEEL
HRTVQKRQQQKDFIDGNVESLMTELEIEKSLKHHEDIVDEIECIEKTLLKRRSELREADR
LLAEAESELSCTKEKTKNAVEKFTDAKRSLLQTESDAEELERRAQETAVNLVKADQQLRS
LQADAKDLEQHKIKQEEILKEINKIVAAKDSDFQCLSKKKEKLTEELQKLQKDIEMAERN
EDHHLQVLKESEVLLQAKRAELEKLKSQVTSQQQEMAVLDRQLGHKKEELHLLQGSMVQA
KADLQEALRLGETEVTEKCNHIREVKSLLEELSFQKGELNVQISERKTQLTLIKQEIEKE
EENLQVVLRQMSKHKTELKNILDMLQLENHELQGLKLQHDQRVSELEKTQVAVLEEKLEL
ENLQQISQQQKGEIEWQKQLLERDKREIERMTAESRALQSCVECLSKEKEDLQEKCDIWE
KKLAQTKRVLAAAEENSKMEQSNLEKLELNVRKLQQELDQLNRDKLSLHNDISAMQQQLQ
EKREAVNSLQEELANVQDHLNLAKQDLLHTTKHQDVLLSEQTRLQKDISEWANRFEDCQK
EEETKQQQLQVLQNEIEENKLKLVQQEMMFQRLQKERESEESKLETSKVTLKEQQHQLEK
ELTDQKSKLDQVLSKVLAAEERVRTLQEEERWCESLEKTLSQTKRQLSEREQQLVEKSGE
LLALQKEADSMRADFSLLRNQFLTERKKAEKQVASLKEALKIQRSQLEKNLLEQKQENSC
IQKEMATIELVAQDNHERARRLMKELNQMQYEYTELKKQMANQKDLERRQMEISDAMRTL
KSEVKDEIRTSLKNLNQFLPELPADLEAILERNENLEGELESLKENLPFTMNEGPFEEKL
NFSQVHIMDEHWRGEALREKLRHREDRLKAQLRHCMSKQAEVLIKGKRQTEGTLHSLRRQ
VDALGELVTSTSADSASSPSLSQLESSLTEDSQLGQNQEKNASAR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AL36	0.126	0.126	0.000	2334	0.809	0.805	A2AL36.pdb.gz	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
2	AFDB:Q7Z7A1	1.000	1.000	0.000	2325	1.000	1.000	Q7Z7A1.pdb.gz	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
3	PDB:6hkwA	0.062	0.428	4.754E-10	306	0.022	0.167	6hkwA.pdb.gz
4	AFDB:Q9C099	0.069	0.152	1.867E-8	1032	0.090	0.203	Q9C099.pdb.gz	LRCC1_HUMAN Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRCC1 PE=1 SV=2
5	PDB:7a5pW	0.062	0.708	9.119E-8	174	0.020	0.270	7a5pW.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
6	AFDB:Q387G4	0.065	0.151	9.921E-8	948	0.079	0.193	Q387G4.pdb.gz	Q387G4_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0280 PE=4 SV=1
7	PDB:6g90W	0.063	0.764	1.173E-6	170	0.017	0.235	6g90W.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
8	PDB:3jb9j	0.057	0.789	2.451E-6	160	0.017	0.244	3jb9j.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
9	PDB:7p5vB	0.061	0.181	9.700E-6	732	0.019	0.060	7p5vB.pdb.gz
10	PDB:7tvfD	0.057	0.235	1.437E-5	515	0.019	0.085	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
11	PDB:1m9sA	0.057	0.230	1.837E-5	523	0.017	0.076	1m9sA.pdb.gz
12	PDB:6xzqG	0.053	0.634	3.312E-5	158	0.018	0.266	6xzqG.pdb.gz	Host ANP32A mediates the assembly of the influenza virus replicase.
13	PDB:1dceA	0.055	0.205	1.188E-4	567	0.014	0.058	1dceA.pdb.gz	Crystal structure of Rab geranylgeranyltransferase at 2.0 A resolution.
14	PDB:7ax1A	0.043	0.172	1.519E-4	518	0.016	0.071	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
15	AFDB:Q9NXG0	0.043	0.058	2.331E-4	1405	0.097	0.160	Q9NXG0.pdb.gz	CNTLN_HUMAN Centlein OS=Homo sapiens OX=9606 GN=CNTLN PE=1 SV=6
16	AFDB:O76329	0.045	0.054	4.442E-3	1738	0.105	0.140	O76329.pdb.gz	ACTNB_DICDI Interaptin OS=Dictyostelium discoideum OX=44689 GN=abpD PE=1 SV=1
17	AFDB:Q96JA1	0.060	0.124	5.406E-3	1093	0.019	0.040	Q96JA1.pdb.gz	LRIG1_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 1 OS=Homo sapiens OX=9606 GN=LRIG1 PE=1 SV=2
18	AFDB:D3ZK41	0.053	0.139	4.695E-2	846	0.021	0.057	D3ZK41.pdb.gz	D3ZK41_RAT SLIT and NTRK-like family, member 2 OS=Rattus norvegicus OX=10116 GN=Slitrk2 PE=4 SV=2
19	AFDB:P91643	0.057	0.144	5.180E-2	880	0.022	0.058	P91643.pdb.gz	P91643_DROME KEK1 OS=Drosophila melanogaster OX=7227 GN=kek1 PE=1 SV=1
20	AFDB:Q387T9	0.047	0.057	6.002E-2	1748	0.080	0.107	Q387T9.pdb.gz	Q387T9_TRYB2 RING-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0560 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AL36	0.0	3615	2334	0.805	0.802	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
2	Q7Z7A1	0.0	4672	2325	1.000	1.000	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
3	Q6ZRR7	5.22e-16	87.4	1453	0.029	0.047	LRRC9_HUMAN Leucine-rich repeat-containing protein 9 OS=Homo sapiens OX=9606 GN=LRRC9 PE=2 SV=2
4	A0A140VJN4	9.94e-14	79.3	725	0.032	0.103	A0A140VJN4_HUMAN Dynein axonemal assembly factor 1 OS=Homo sapiens OX=9606 PE=2 SV=1
5	Q8NEP3	9.94e-14	79.3	725	0.032	0.103	DAAF1_HUMAN Dynein axonemal assembly factor 1 OS=Homo sapiens OX=9606 GN=DNAAF1 PE=1 SV=5
6	Q86X45	4.27e-13	76.6	466	0.029	0.144	DAA11_HUMAN Dynein axonemal assembly factor 11 OS=Homo sapiens OX=9606 GN=DNAAF11 PE=1 SV=3
7	Q9H069	9.36e-13	75.9	523	0.034	0.151	DRC3_HUMAN Dynein regulatory complex subunit 3 OS=Homo sapiens OX=9606 GN=DRC3 PE=1 SV=2
8	Q9VQV7	1.85e-12	75.5	806	0.025	0.072	Q9VQV7_DROME Centrosomal protein 97kDa, isoform B OS=Drosophila melanogaster OX=7227 GN=Cep97 PE=3 SV=3
9	Q5AHH6	2.51e-12	73.6	374	0.023	0.142	Q5AHH6_CANAL Type 1 protein phosphatase-activating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SDS22 PE=4 SV=1
10	O88978	2.76e-12	73.9	473	0.025	0.123	DAA11_MOUSE Dynein axonemal assembly factor 11 OS=Mus musculus OX=10090 GN=Dnaaf11 PE=1 SV=1
11	Q9C099	3.85e-12	74.7	1032	0.025	0.057	LRCC1_HUMAN Leucine-rich repeat and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LRRCC1 PE=1 SV=2
12	Q9D5E4	5.76e-12	73.2	523	0.025	0.109	DRC3_MOUSE Dynein regulatory complex subunit 3 OS=Mus musculus OX=10090 GN=Drc3 PE=1 SV=1
13	A0A1L8G016	9.52e-12	72.4	469	0.028	0.139	DAA11_XENLA Dynein axonemal assembly factor 11 OS=Xenopus laevis OX=8355 GN=dnaaf11 PE=3 SV=1
14	Q7ZV84	1.30e-11	72.4	555	0.025	0.105	DAAF1_DANRE Dynein axonemal assembly factor 1 OS=Danio rerio OX=7955 GN=dnaaf1 PE=2 SV=2
15	Q9VL65	1.34e-11	72.4	566	0.034	0.138	Q9VL65_DROME TbCMF46 OS=Drosophila melanogaster OX=7227 GN=TbCMF46 PE=4 SV=2
16	O35125	1.68e-11	70.5	340	0.019	0.132	LRC23_MOUSE Leucine-rich repeat-containing protein 23 OS=Mus musculus OX=10090 GN=Lrrc23 PE=1 SV=1
17	Q15435	9.10e-11	68.6	360	0.020	0.131	PP1R7_HUMAN Protein phosphatase 1 regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PPP1R7 PE=1 SV=1
18	Q3UM45	1.07e-10	68.2	361	0.020	0.130	PP1R7_MOUSE Protein phosphatase 1 regulatory subunit 7 OS=Mus musculus OX=10090 GN=Ppp1r7 PE=1 SV=2
19	Q9VR52	1.08e-10	68.6	395	0.026	0.152	TILB_DROME Protein tilB OS=Drosophila melanogaster OX=7227 GN=tilB PE=1 SV=1
20	Q53EV4	8.07e-10	65.5	343	0.020	0.137	LRC23_HUMAN Leucine-rich repeat-containing protein 23 OS=Homo sapiens OX=9606 GN=LRRC23 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13851 GAS	3	18.7	Growth-arrest specific micro-tubule binding
2	PF00560 LRR_1	18	17.1	Leucine Rich Repeat
3	PF12799 LRR_4	2.6e-07	42.1	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	0.15	23.2	Leucine Rich repeat
5	PF13855 LRR_8	4.6e-08	44.0	Leucine rich repeat
6	PF14580 LRR_9	5.4e-13	60.4	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362962

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000403453	0.959	Outer dense fiber protein 2
2	9606.ENSP00000371472	0.956	Ninein
3	9606.ENSP00000451162	0.933	Centrosomal protein 128
4	9606.ENSP00000355500	0.931	Centrosomal protein of 170 kDa
5	9606.ENSP00000474071	0.875	Coiled-coil domain-containing protein 120
6	9606.ENSP00000355812	0.858	FGFR1 oncogene partner
7	9606.ENSP00000354791	0.825	Dynactin subunit 1
8	9606.ENSP00000466690	0.812	Coiled-coil domain-containing protein 68
9	9606.ENSP00000360540	0.806	Centrosomal protein of 55 kDa
10	9606.ENSP00000385000	0.794	Kinesin-like protein KIF2A
11	9606.ENSP00000352572	0.784	Pericentrin
12	9606.ENSP00000393312	0.763	Fibroblast growth factor receptor 1
13	9606.ENSP00000380661	0.738	Centrosome-associated protein CEP250
14	9606.ENSP00000479904	0.730	Zinc finger MYM-type protein 2
15	9606.ENSP00000377668	0.727	Sulfite oxidase, mitochondrial
16	9606.ENSP00000266679	0.723	Cleavage and polyadenylation specificity factor subunit 6
17	9606.ENSP00000260762	0.704	Exocyst complex component 6
18	9606.ENSP00000229395	0.703	FGFR1 oncogene partner 2
19	9606.ENSP00000261890	0.701	Ras-related protein Rab-11A
20	9606.ENSP00000278935	0.698	Centrosomal protein of 164 kDa

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0032502	0.960	developmental process
GO:0032501	0.952	multicellular organismal process
GO:0048856	0.951	anatomical structure development
GO:0022414	0.936	reproductive process
GO:0051301	0.927	cell division
GO:0048731	0.893	system development
GO:0048609	0.871	multicellular organismal reproductive process
GO:0065007	0.859	biological regulation
GO:0007276	0.857	gamete generation
GO:0050794	0.853	regulation of cellular process
GO:0071840	0.638	cellular component organization or biogenesis
GO:0016043	0.583	cellular component organization
GO:0006996	0.443	organelle organization
GO:0072359	0.428	circulatory system development
GO:0003006	0.411	developmental process involved in reproduction
GO:0007049	0.391	cell cycle
GO:0030154	0.378	cell differentiation
GO:0048513	0.366	animal organ development
GO:0050896	0.352	response to stimulus
GO:0022402	0.337	cell cycle process
GO:0007292	0.332	female gamete generation
GO:0007281	0.332	germ cell development
GO:0001944	0.331	vasculature development
GO:0098722	0.325	asymmetric stem cell division
GO:0042078	0.324	germ-line stem cell division
GO:0048518	0.319	positive regulation of biological process
GO:0048477	0.319	oogenesis
GO:0001822	0.313	kidney development
GO:0048522	0.306	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005813	0.995	centrosome
GO:0032991	0.992	protein-containing complex
GO:0043227	0.989	membrane-bounded organelle
GO:0016020	0.986	membrane
GO:0120025	0.909	plasma membrane bounded cell projection
GO:0005929	0.903	cilium
GO:0043231	0.872	intracellular membrane-bounded organelle
GO:0140535	0.652	intracellular protein-containing complex
GO:0070013	0.580	intracellular organelle lumen
GO:0031981	0.571	nuclear lumen
GO:0005819	0.438	spindle
GO:0034451	0.429	centriolar satellite
GO:0012505	0.390	endomembrane system
GO:0005654	0.383	nucleoplasm
GO:0000922	0.382	spindle pole
GO:0120103	0.373	centriolar subdistal appendage

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]