StarFunc result for job id Q7Z7B0

User Input

>input (1213 residues)
MRSRNQGGESASDGHISCPKPSIIGNAGEKSLSEDAKKKKKSNRKEDDVMASGTVKRHLK
TSGECERKTKKSLELSKEDLIQLLSIMEGELQAREDVIHMLKTEKTKPEVLEAHYGSAEP
EKVLRVLHRDAILAQEKSIGEDVYEKPISELDRLEEKQKETYRRMLEQLLLAEKCHRRTV
YELENEKHKHTDYMNKSDDFTNLLEQERERLKKLLEQEKAYQARKEKENAKRLNKLRDEL
VKLKSFALMLVDERQMHIEQLGLQSQKVQDLTQKLREEEEKLKAITSKSKEDRQKLLKLE
VDFEHKASRFSQEHEEMNAKLANQESHNRQLRLKLVGLTQRIEELEETNKNLQKAEEELQ
ELRDKIAKGECGNSSLMAEVENLRKRVLEMEGKDEEITKTESQCRELRKKLQEEEHHSKE
LRLEVEKLQKRMSELEKLEEAFSKSKSECTQLHLNLEKEKNLTKDLLNELEVVKSRVKEL
ECSESRLEKAELSLKDDLTKLKSFTVMLVDERKNMMEKIKQEERKVDGLNKNFKVEQGKV
MDVTEKLIEESKKLLKLKSEMEEKVYNLTRERDELIGKLKSEEEKSSELSCSVDLLKKRL
DGIEEVEREITRGRSRKGSELTCPEDNKIKELTLEIERLKKRLQQLEVVEGDLMKTEDEY
DQLEQKFRTEQDKANFLSQQLEEIKHQIAKNKAIEKGEVVSQEAELRHRFRLEEAKSRDL
KAEVQALKEKIHELMNKEDQLSQLQVDYSVLQQRFMEEENKNKNMGQEVLNLTKELELSK
RYSRALRPSVNGRRMVDVPVTSTGVQTDAVSGEAAEEETPAVFIRKSFQEENHIMSNLRQ
VGLKKPVERSSVLDRYPPAANELTMRKSWIPWMRKRENGPSITQEKGPRTNSSPGHPGEV
VLSPKQGQPLHIRVTPDHENSTATLEITSPTSEEFFSSTTVIPTLGNQKPRITIIPSPNV
MPQKQKSGDTTLGPERAMSPVTITTFSREKTPESGRGAFADRPTSPIQIMTVSTSAAPAE
IAVSPESQEMPMGRTILKVTPEKQTVPTPVRKYNSNANIITTEDNKIHIHLGSQFKRSPG
TSGEGVSPVITVRPVNVTAEKEVSTGTVLRSPRNHLSSRPGASKVTSTITITPVTTSSAR
GTQSVSGQDGSSQRPTPTRIPMSKGMKAGKPVVAAPGAGNLTKFEPRAETQSMKIELKKS
AASSTTSLGGGKG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CS72	0.243	0.243	0.000	1211	0.932	0.934	Q9CS72.pdb.gz	FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musculus OX=10090 GN=Filip1 PE=1 SV=3
2	AFDB:Q4L180	0.272	0.286	5.279E-72	1135	0.437	0.467	Q4L180.pdb.gz	FIL1L_HUMAN Filamin A-interacting protein 1-like OS=Homo sapiens OX=9606 GN=FILIP1L PE=1 SV=2
3	AFDB:I0J0E7	0.119	0.119	3.076E-15	1217	0.182	0.182	I0J0E7.pdb.gz	NMCP1_ALLCE Nuclear matrix constituent protein 1 OS=Allium cepa OX=4679 GN=NMCP1 PE=2 SV=1
4	AFDB:Q585C9	0.113	0.109	3.956E-14	1271	0.172	0.164	Q585C9.pdb.gz	Q585C9_TRYB2 NUP-1 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.660 PE=4 SV=1
5	AFDB:A0A166B1A6	0.117	0.126	1.050E-13	1119	0.146	0.158	A0A166B1A6.pdb.gz	NMCP1_DAUCS Nuclear matrix constituent protein 1 OS=Daucus carota subsp. sativus OX=79200 GN=NMCP1 PE=1 SV=2
6	AFDB:Q6VGS5	0.084	0.056	5.087E-13	2009	0.189	0.114	Q6VGS5.pdb.gz	DAPLE_MOUSE Protein Daple OS=Mus musculus OX=10090 GN=Ccdc88c PE=1 SV=1
7	AFDB:Q8IR55	0.066	0.034	5.087E-13	2567	0.153	0.072	Q8IR55.pdb.gz	Q8IR55_DROME Mushroom body defect, isoform H OS=Drosophila melanogaster OX=7227 GN=mud PE=1 SV=3
8	AFDB:Q0DY81	0.114	0.118	5.911E-13	1155	0.168	0.177	Q0DY81.pdb.gz	NMCPA_ORYSJ Nuclear matrix constituent protein 1a OS=Oryza sativa subsp. japonica OX=39947 GN=NMCP1A PE=2 SV=1
9	AFDB:A4GSN8	0.106	0.068	7.405E-13	2093	0.160	0.093	A4GSN8.pdb.gz	NUA_ARATH Nuclear-pore anchor OS=Arabidopsis thaliana OX=3702 GN=NUA PE=1 SV=1
10	AFDB:F4HRT5	0.144	0.153	4.843E-12	1132	0.160	0.171	F4HRT5.pdb.gz	CRWN1_ARATH Protein CROWDED NUCLEI 1 OS=Arabidopsis thaliana OX=3702 GN=CRWN1 PE=1 SV=1
11	PDB:4v60A	0.061	0.086	6.815	812	0.028	0.042	4v60A.pdb.gz
12	PDB:6hivAg	0.041	0.158	6.815	259	0.013	0.062	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
13	PDB:5xtdW	0.039	0.206	7.347	138	0.015	0.130	5xtdW.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
14	PDB:7fd4B	0.046	0.065	8.538	779	0.014	0.022	7fd4B.pdb.gz	Complete three-dimensional structures of the Lon protease translocating a protein substrate.
15	PDB:6tdaO	0.029	0.137	9.922	212	0.012	0.066	6tdaO.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A075B6G6	0.0	2248	1114	0.918	1.000	A0A075B6G6_HUMAN Filamin A interacting protein 1 OS=Homo sapiens OX=9606 GN=FILIP1 PE=1 SV=1
2	Q4L180	0.0	893	1135	0.437	0.467	FIL1L_HUMAN Filamin A-interacting protein 1-like OS=Homo sapiens OX=9606 GN=FILIP1L PE=1 SV=2
3	Q7Z7B0	0.0	2450	1213	1.000	1.000	FLIP1_HUMAN Filamin-A-interacting protein 1 OS=Homo sapiens OX=9606 GN=FILIP1 PE=1 SV=1
4	Q8K4T4	0.0	2289	1212	0.935	0.936	FLIP1_RAT Filamin-A-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Filip1 PE=1 SV=1
5	Q9CS72	0.0	2290	1214	0.936	0.935	FLIP1_MOUSE Filamin-A-interacting protein 1 OS=Mus musculus OX=10090 GN=Filip1 PE=1 SV=3
6	Q86V48	1.46e-75	274	1076	0.179	0.202	LUZP1_HUMAN Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2
7	Q8R4U7	1.02e-65	244	1068	0.170	0.193	LUZP1_MOUSE Leucine zipper protein 1 OS=Mus musculus OX=10090 GN=Luzp1 PE=1 SV=2
8	Q9P2B4	1.68e-28	125	639	0.077	0.146	CT2NL_HUMAN CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2
9	Q99LJ0	2.91e-28	124	638	0.077	0.147	CT2NL_MOUSE CTTNBP2 N-terminal-like protein OS=Mus musculus OX=10090 GN=Cttnbp2nl PE=1 SV=1
10	Q8SX68	3.83e-18	92.4	609	0.068	0.136	CT2NL_DROME CTTNBP2 N-terminal-like protein OS=Drosophila melanogaster OX=7227 GN=Naus PE=1 SV=1
11	Q95QQ9	1.88e-16	86.7	552	0.057	0.125	Q95QQ9_CAEEL Cortactin-binding protein-2 N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C49H3.6 PE=1 SV=2
12	H2KZD4	3.12e-16	85.5	498	0.056	0.137	H2KZD4_CAEEL Cortactin-binding protein-2 N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C49H3.6 PE=1 SV=1
13	Q8WZ74	1.28e-11	72.0	1663	0.063	0.046	CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens OX=9606 GN=CTTNBP2 PE=1 SV=1
14	B9EJA2	2.32e-10	67.8	1648	0.063	0.047	CTTB2_MOUSE Cortactin-binding protein 2 OS=Mus musculus OX=10090 GN=Cttnbp2 PE=1 SV=2
15	Q2IBD4	6.17e-10	66.6	1649	0.060	0.044	CTTB2_RAT Cortactin-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cttnbp2 PE=1 SV=1
16	B9EKI3	0.012	42.4	1091	0.074	0.082	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
17	Q9UQE7	0.023	41.6	1217	0.037	0.037	SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2
18	Q9CW03	0.024	41.6	1217	0.037	0.037	SMC3_MOUSE Structural maintenance of chromosomes protein 3 OS=Mus musculus OX=10090 GN=Smc3 PE=1 SV=2
19	Q57UV7	0.029	41.2	1456	0.098	0.082	Q57UV7_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.4A8.660 PE=3 SV=1
20	Q8AWB8	0.033	41.2	1217	0.036	0.036	Q8AWB8_CHICK Structural maintenance of chromosomes protein OS=Gallus gallus OX=9031 GN=SMC3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09727 CortBP2	3.8e-58	208.1	Cortactin-binding protein-2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000237172

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358866	0.876	Filamin-A
2	9606.ENSP00000437188	0.678	T-lymphoma invasion and metastasis-inducing protein 2
3	9606.ENSP00000414359	0.642	Proteasome subunit alpha type-1
4	9606.ENSP00000220853	0.637	ER membrane protein complex subunit 2
5	9606.ENSP00000400895	0.636	Otogelin-like protein
6	9606.ENSP00000230461	0.606	Cell cycle control protein 50A
7	9606.ENSP00000419945	0.602	Syncytin-1
8	9606.ENSP00000370671	0.594	Kelch-like protein 42
9	9606.ENSP00000304078	0.586	Protein FAM83B
10	9606.ENSP00000402527	0.544	Sentrin-specific protease 6
11	9606.ENSP00000356133	0.529	Claudin-20
12	9606.ENSP00000305725	0.518	Carbohydrate sulfotransferase 11
13	9606.ENSP00000240185	0.517	TAR DNA-binding protein 43
14	9606.ENSP00000344233	0.517	Leucine-rich repeat-containing protein 43
15	9606.ENSP00000245312	0.511	Ileal sodium/bile acid cotransporter
16	9606.ENSP00000266014	0.509	Glycosyltransferase 8 domain containing 1
17	9606.ENSP00000354504	0.508	Astrotactin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071840	0.985	cellular component organization or biogenesis
GO:0016043	0.961	cellular component organization
GO:0034330	0.844	cell junction organization
GO:0065007	0.794	biological regulation
GO:0050808	0.758	synapse organization
GO:0050789	0.718	regulation of biological process
GO:0050794	0.699	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005886	0.995	plasma membrane
GO:0031981	0.995	nuclear lumen
GO:0005829	0.992	cytosol
GO:0005856	0.986	cytoskeleton
GO:0030054	0.974	cell junction
GO:0015629	0.911	actin cytoskeleton
GO:0098978	0.776	glutamatergic synapse
GO:0005654	0.596	nucleoplasm
GO:0005730	0.471	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]