StarFunc result for job id Q7Z7B1

User Input

>input (504 residues)
MSEKQMKEAFVSNLNGTTVLEITQGLCFPAFCILCRGFLIIFSQYLCSFSPTWKTRFLTD
FVVLIVPMVATLTIWASFILLELLGVIIFGAGLLYQIYRRRTCYARLPFLKILEKFLNIS
LESEYNPAISCFRVITSAFTAIAILAVDFPLFPRRFAKTELYGTGAMDFGVGGFVFGSAM
VCLEVRRRKYMEGSKLHYFTNSLYSVWPLVFLGIGRLAIIKSIGYQEHLTEYGVHWNFFF
TIIVVKLITPLLLIIFPLNKSWIIALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLN
ANREGIISTLGYVAIHMAGVQTGLYMHKNRSHIKDLIKVACFLLLAAISLFISLYVVQVN
VEAVSRRMANLAFCIWIVASSLILLSSLLLGDIILSFAKFLIKGALVPCSWKLIQSPVTN
KKHSESLVPEAERMEPSLCLITALNRKQLIFFLLSNITTGLINLMVDTLHSSTLWALFVV
NLYMFSNCLIVYVLYLQDKTVQFW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z7B1	1.000	1.000	1.246E-69	504	1.000	1.000	Q7Z7B1.pdb.gz	PIGW_HUMAN Phosphatidylinositol-glycan biosynthesis class W protein OS=Homo sapiens OX=9606 GN=PIGW PE=1 SV=1
2	AFDB:P47026	0.770	0.791	4.031E-24	490	0.296	0.304	P47026.pdb.gz	GWT1_YEAST GPI-anchored wall transfer protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GWT1 PE=1 SV=2
3	AFDB:Q873N1	0.784	0.788	4.841E-23	501	0.296	0.297	Q873N1.pdb.gz	GWT1_ASPFU GPI-anchored wall transfer protein 1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=gwt1 PE=3 SV=2
4	AFDB:Q873N2	0.760	0.788	5.053E-23	485	0.272	0.282	Q873N2.pdb.gz	GWT1_CANAL GPI-anchored wall transfer protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GWT1 PE=3 SV=2
5	AFDB:Q9UTL4	0.739	0.807	3.191E-22	459	0.290	0.318	Q9UTL4.pdb.gz	GWT1_SCHPO GPI-anchored wall transfer protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gwt1 PE=1 SV=1
6	AFDB:Q68CP4	0.465	0.369	1.189E-4	663	0.123	0.094	Q68CP4.pdb.gz	HGNAT_HUMAN Heparan-alpha-glucosaminide N-acetyltransferase OS=Homo sapiens OX=9606 GN=HGSNAT PE=1 SV=2
7	AFDB:Q3UDW8	0.452	0.362	1.675E-4	656	0.117	0.090	Q3UDW8.pdb.gz	HGNAT_MOUSE Heparan-alpha-glucosaminide N-acetyltransferase OS=Mus musculus OX=10090 GN=Hgsnat PE=1 SV=2
8	AFDB:Q9XVW1	0.305	0.306	1.166E-2	502	0.119	0.120	Q9XVW1.pdb.gz	RHY1_CAEEL Regulator of hypoxia-inducible factor 1 OS=Caenorhabditis elegans OX=6239 GN=rhy-1 PE=1 SV=1
9	AFDB:Q389C9	0.155	0.113	1.270E-2	791	0.151	0.096	Q389C9.pdb.gz	Q389C9_TRYB2 Acyltransferase 3 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1600 PE=4 SV=1
10	AFDB:Q6FQ03	0.120	0.105	1.384E-2	630	0.123	0.098	Q6FQ03.pdb.gz	TPO3_CANGA Multidrug transporter TPO3 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=TPO3 PE=2 SV=1
11	PDB:4u4tA	0.186	0.203	6.239E-2	444	0.125	0.142	4u4tA.pdb.gz	Structural basis for dynamic mechanism of nitrate/nitrite antiport by NarK
12	PDB:4f4cA	0.104	0.052	8.422E-2	1250	0.089	0.036	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
13	PDB:4jr9A	0.204	0.234	1.602E-1	409	0.103	0.127	4jr9A.pdb.gz	Crystal structure of a nitrate/nitrite exchanger.
14	PDB:2nuuD	0.103	0.119	2.257E-1	410	0.107	0.132	2nuuD.pdb.gz	The crystal structure of the Escherichia coli AmtB-GlnK complex reveals how GlnK regulates the ammonia channel
15	PDB:5j4nA	0.117	0.127	3.465E-1	437	0.127	0.146	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
16	PDB:2wsxA	0.141	0.142	3.775E-1	496	0.133	0.135	2wsxA.pdb.gz	Structural Basis of Na(+)-Independent and Cooperative Substrate/Product Antiport in Cait.
17	PDB:3o7qA	0.161	0.185	5.794E-1	414	0.123	0.150	3o7qA.pdb.gz
18	PDB:5djqA	0.156	0.166	6.048E-1	466	0.109	0.118	5djqA.pdb.gz	The structure of cbb3 cytochrome oxidase provides insights into proton pumping.
19	PDB:7bc7A	0.133	0.146	6.313E-1	432	0.123	0.144	7bc7A.pdb.gz	Structural basis of antifolate recognition and transport by PCFT.
20	PDB:7sptA	0.184	0.192	7.179E-1	470	0.111	0.119	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z7B1	0.0	1019	504	1.000	1.000	PIGW_HUMAN Phosphatidylinositol-glycan biosynthesis class W protein OS=Homo sapiens OX=9606 GN=PIGW PE=1 SV=1
2	Q873N1	3.03e-51	184	501	0.323	0.325	GWT1_ASPFU GPI-anchored wall transfer protein 1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=gwt1 PE=3 SV=2
3	P47026	6.73e-50	180	490	0.323	0.333	GWT1_YEAST GPI-anchored wall transfer protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GWT1 PE=1 SV=2
4	Q873N2	2.19e-43	162	485	0.312	0.324	GWT1_CANAL GPI-anchored wall transfer protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GWT1 PE=3 SV=2
5	Q9UTL4	4.37e-43	160	459	0.319	0.351	GWT1_SCHPO GPI-anchored wall transfer protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gwt1 PE=1 SV=1
6	A0A140JWM8	0.14	37.0	473	0.056	0.059	C7162_ARATH Cytochrome P450 716A2 OS=Arabidopsis thaliana OX=3702 GN=CYP716A2 PE=2 SV=1
7	A0A0U2U8U5	0.19	36.6	475	0.042	0.044	C7A81_BARVU Beta-amyrin 28-monooxygenase OS=Barbarea vulgaris OX=50459 GN=CYP716A81 PE=1 SV=1
8	A0A3Q7HBJ5	0.39	35.8	476	0.036	0.038	C7A44_SOLLC Beta-amyrin 28-monooxygenase OS=Solanum lycopersicum OX=4081 GN=CYP716A44 PE=1 SV=1
9	Q2MJ20	0.68	35.0	479	0.058	0.061	C7A12_MEDTR Beta-amyrin 28-monooxygenase OS=Medicago truncatula OX=3880 GN=CYP716A12 PE=1 SV=1
10	Q9LVY7	2.3	33.1	477	0.040	0.042	C7161_ARATH Cytochrome P450 716A1 OS=Arabidopsis thaliana OX=3702 GN=CYP716A1 PE=3 SV=1
11	A0A0S2II38	2.6	33.1	481	0.071	0.075	C7A94_KALSE Beta-amyrin 28-monooxygenase OS=Kalopanax septemlobus OX=228393 GN=CYP716A94 PE=1 SV=1
12	I7C6E8	6.5	32.0	481	0.073	0.077	C7A52_PANGI Beta-amyrin 28-monooxygenase OS=Panax ginseng OX=4054 GN=CYP716A52v2 PE=1 SV=1
13	F6H9N6	9.9	31.2	480	0.036	0.037	C7A15_VITVI Beta-amyrin 28-monooxygenase OS=Vitis vinifera OX=29760 GN=CYP716A15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06143 Baculo_11_kDa	1.8e+02	13.1	Baculovirus 11 kDa family
2	PF06423 GWT1	5.1e-32	122.6	GWT1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482202

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225609	0.979	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
2	9606.ENSP00000357069	0.977	GPI mannosyltransferase 1
3	9606.ENSP00000230036	0.935	Phosphatidylinositol-glycan-specific phospholipase D
4	9606.ENSP00000300658	0.876	Post-GPI attachment to proteins factor 3
5	9606.ENSP00000350263	0.864	GPI ethanolamine phosphate transferase 1
6	9606.ENSP00000369820	0.842	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
7	9606.ENSP00000367880	0.830	GPI ethanolamine phosphate transferase 3
8	9606.ENSP00000164305	0.828	GPI mannosyltransferase 3
9	9606.ENSP00000363260	0.827	GPI mannosyltransferase 2
10	9606.ENSP00000415203	0.824	GPI ethanolamine phosphate transferase 2
11	9606.ENSP00000026218	0.819	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
12	9606.ENSP00000420037	0.798	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
13	9606.ENSP00000346809	0.797	GPI inositol-deacylase
14	9606.ENSP00000278243	0.779	Post-GPI attachment to proteins factor 2
15	9606.ENSP00000360644	0.772	Dolichol-phosphate mannosyltransferase subunit 1
16	9606.ENSP00000432688	0.735	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y
17	9606.ENSP00000356702	0.729	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
18	9606.ENSP00000279036	0.714	GPI transamidase component PIG-T
19	9606.ENSP00000216452	0.703	Phosphatidylinositol N-acetylglucosaminyltransferase subunit H
20	9606.ENSP00000310435	0.703	Beta/gamma crystallin domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008374	1.000	O-acyltransferase activity
GO:0005488	0.325	binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:1901576	0.990	organic substance biosynthetic process
GO:0044260	0.990	cellular macromolecule metabolic process
GO:0006629	0.986	lipid metabolic process
GO:0036211	0.986	protein modification process
GO:1990778	0.985	protein localization to cell periphery
GO:0044249	0.984	cellular biosynthetic process
GO:0072657	0.983	protein localization to membrane
GO:0044255	0.971	cellular lipid metabolic process
GO:0008610	0.971	lipid biosynthetic process
GO:1901566	0.964	organonitrogen compound biosynthetic process
GO:0034645	0.963	cellular macromolecule biosynthetic process
GO:0006796	0.957	phosphate-containing compound metabolic process
GO:0006664	0.955	glycolipid metabolic process
GO:0006506	0.949	GPI anchor biosynthetic process
GO:0072659	0.948	protein localization to plasma membrane
GO:0016254	0.349	preassembly of GPI anchor in ER membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.998	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.

[back to server]