StarFunc result for job id Q7Z7C8

User Input

>input (310 residues)
MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVET
LTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVIT
APPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAA
SQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEET
DSSEQDEQTDTENLALHISMEDSGAEKENTSVLQQNPSLSGSRNGEENIIDNPYLRPVKK
PKIRRKKSLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z7C8	1.000	1.000	6.710E-52	310	1.000	1.000	Q7Z7C8.pdb.gz	TAF8_HUMAN Transcription initiation factor TFIID subunit 8 OS=Homo sapiens OX=9606 GN=TAF8 PE=1 SV=1
2	PDB:7edxH	0.322	0.474	2.198E-31	209	0.671	0.995	7edxH.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
3	AFDB:Q9VWY6	0.304	0.288	9.710E-21	328	0.358	0.338	Q9VWY6.pdb.gz	TAF8_DROME Transcription initiation factor TFIID subunit 8 OS=Drosophila melanogaster OX=7227 GN=Taf8 PE=1 SV=1
4	PDB:6mzcK	0.298	0.448	3.888E-20	202	0.497	0.762	6mzcK.pdb.gz
5	AFDB:Q9VP40	0.296	0.332	6.589E-12	275	0.194	0.218	Q9VP40.pdb.gz	Q9VP40_DROME Transcription initiation factor TFIID subunit 8 OS=Drosophila melanogaster OX=7227 GN=sa PE=2 SV=1
6	AFDB:Q9SYZ9	0.311	0.275	2.521E-9	353	0.213	0.187	Q9SYZ9.pdb.gz	TAF8_ARATH Transcription initiation factor TFIID subunit 8 OS=Arabidopsis thaliana OX=3702 GN=TAF8 PE=1 SV=1
7	PDB:7edxc	0.308	0.704	4.118E-6	127	0.094	0.228	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
8	AFDB:Q9SHF8	0.237	0.234	1.828E-5	314	0.132	0.131	Q9SHF8.pdb.gz	Q9SHF8_ARATH T19E23.2 OS=Arabidopsis thaliana OX=3702 GN=At1g31240 PE=1 SV=1
9	AFDB:Q27272	0.198	0.220	3.047E-4	278	0.155	0.173	Q27272.pdb.gz	TAF9_DROME Transcription initiation factor TFIID subunit 9 OS=Drosophila melanogaster OX=7227 GN=e(y)1 PE=1 SV=1
10	AFDB:Q9V4D4	0.314	0.077	3.249E-4	1406	0.197	0.043	Q9V4D4.pdb.gz	Q9V4D4_DROME Bip2 OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=1 SV=1
11	AFDB:Q03750	0.281	0.179	4.768E-4	510	0.142	0.086	Q03750.pdb.gz	TAF8_YEAST Transcription initiation factor TFIID subunit 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF8 PE=1 SV=1
12	AFDB:Q67XJ2	0.238	0.402	9.038E-4	176	0.106	0.188	Q67XJ2.pdb.gz	NFYBA_ARATH Nuclear transcription factor Y subunit B-10 OS=Arabidopsis thaliana OX=3702 GN=NFYB10 PE=1 SV=1
13	AFDB:Q75IZ7	0.229	0.317	1.095E-3	219	0.126	0.178	Q75IZ7.pdb.gz	NFYB8_ORYSJ Nuclear transcription factor Y subunit B-8 OS=Oryza sativa subsp. japonica OX=39947 GN=NFYB8 PE=1 SV=1
14	PDB:3v9rA	0.241	0.758	2.313E-3	88	0.045	0.159	3v9rA.pdb.gz
15	PDB:7egdF	0.204	0.158	6.435E-3	412	0.074	0.056	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
16	PDB:7ktrE	0.196	0.466	1.478E-2	124	0.074	0.185	7ktrE.pdb.gz	Structure of the human SAGA coactivator complex.
17	PDB:1kx5B	0.193	0.545	1.908E-2	102	0.074	0.225	1kx5B.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
18	PDB:5y27A	0.213	0.631	2.169E-2	98	0.035	0.112	5y27A.pdb.gz
19	PDB:7ktrH	0.190	0.535	2.986E-2	99	0.065	0.202	7ktrH.pdb.gz	Structure of the human SAGA coactivator complex.
20	PDB:1b67A	0.197	0.833	3.393E-2	68	0.039	0.176	1b67A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z7C8	0.0	638	310	1.000	1.000	TAF8_HUMAN Transcription initiation factor TFIID subunit 8 OS=Homo sapiens OX=9606 GN=TAF8 PE=1 SV=1
2	Q9EQH4	0.0	577	308	0.945	0.951	TAF8_MOUSE Transcription initiation factor TFIID subunit 8 OS=Mus musculus OX=10090 GN=Taf8 PE=2 SV=1
3	B4DZU5	2.31e-171	476	234	0.752	0.996	B4DZU5_HUMAN Transcription initiation factor TFIID subunit 8 OS=Homo sapiens OX=9606 GN=TAF8 PE=1 SV=1
4	A0A0A0MRR3	2.15e-118	339	174	0.529	0.943	A0A0A0MRR3_HUMAN Transcription initiation factor TFIID subunit 8 OS=Homo sapiens OX=9606 GN=TAF8 PE=1 SV=1
5	Q9VWY6	3.27e-65	209	328	0.381	0.360	TAF8_DROME Transcription initiation factor TFIID subunit 8 OS=Drosophila melanogaster OX=7227 GN=Taf8 PE=1 SV=1
6	Q9SYZ9	4.04e-13	71.2	353	0.174	0.153	TAF8_ARATH Transcription initiation factor TFIID subunit 8 OS=Arabidopsis thaliana OX=3702 GN=TAF8 PE=1 SV=1
7	Q9VP40	1.16e-11	66.2	275	0.184	0.207	Q9VP40_DROME Transcription initiation factor TFIID subunit 8 OS=Drosophila melanogaster OX=7227 GN=sa PE=2 SV=1
8	O94706	5.54e-08	54.7	222	0.148	0.207	TAF8_SCHPO Transcription initiation factor TFIID subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf8 PE=3 SV=1
9	Q5HZG4	5.94e-07	53.1	932	0.081	0.027	TAF3_MOUSE Transcription initiation factor TFIID subunit 3 OS=Mus musculus OX=10090 GN=Taf3 PE=1 SV=2
10	Q5VWG9	4.56e-06	50.4	929	0.077	0.026	TAF3_HUMAN Transcription initiation factor TFIID subunit 3 OS=Homo sapiens OX=9606 GN=TAF3 PE=1 SV=1
11	Q5RH27	4.62e-05	47.4	898	0.065	0.022	Q5RH27_DANRE TAF3 RNA polymerase II, TATA box-binding protein (TBP)-associated facto OS=Danio rerio OX=7955 GN=fi76b06 PE=4 SV=2
12	Q8MSB9	1.46e-04	45.4	370	0.068	0.057	Q8MSB9_DROME LD24176p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=2 SV=1
13	Q9XZU7	1.93e-04	45.4	1408	0.068	0.015	Q9XZU7_DROME Bip2 protein OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=2 SV=1
14	Q9U1I0	2.72e-04	45.1	1406	0.068	0.015	Q9U1I0_DROME BIP2 protein OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=4 SV=1
15	Q9V4D4	2.80e-04	45.1	1406	0.068	0.015	Q9V4D4_DROME Bip2 OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=1 SV=1
16	Q03750	0.002	42.4	510	0.055	0.033	TAF8_YEAST Transcription initiation factor TFIID subunit 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TAF8 PE=1 SV=1
17	Q9SYH2	0.38	33.9	183	0.048	0.082	TAF9_ARATH Transcription initiation factor TFIID subunit 9 OS=Arabidopsis thaliana OX=3702 GN=TAF9 PE=1 SV=1
18	Q9SFD8	0.43	34.3	238	0.087	0.113	NFYB9_ARATH Nuclear transcription factor Y subunit B-9 OS=Arabidopsis thaliana OX=3702 GN=NFYB9 PE=1 SV=2
19	Q67XJ2	0.80	33.1	176	0.077	0.136	NFYBA_ARATH Nuclear transcription factor Y subunit B-10 OS=Arabidopsis thaliana OX=3702 GN=NFYB10 PE=1 SV=1
20	Q84W66	1.4	32.7	234	0.058	0.077	NFYB6_ARATH Nuclear transcription factor Y subunit B-6 OS=Arabidopsis thaliana OX=3702 GN=NFYB6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07524 Bromo_TP	7.6e-27	104.5	Bromodomain associated
2	PF17027 Bromo_TP_like	0.43	22.1	Histone-fold protein
3	PF15630 CENP-S	1.3e+02	14.4	CENP-S protein
4	PF15511 CENP-T_C	3.7e+02	12.6	Centromere kinetochore component CENP-T histone fold
5	PF15291 Dermcidin	64	15.6	Dermcidin, antibiotic peptide
6	PF11290 DUF3090	9.9	17.5	Protein of unknown function (DUF3090)
7	PF10406 TAF8_C	8.9e-20	82.2	Transcription factor TFIID complex subunit 8 C-term
8	PF02291 TFIID-31kDa	1.5	20.3	Transcription initiation factor IID, 31kD subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362068

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252996	0.999	Transcription initiation factor TFIID subunit 4
2	9606.ENSP00000263974	0.999	Transcription initiation factor TFIID subunit 12
3	9606.ENSP00000299424	0.999	Transcription initiation factor TFIID subunit 10
4	9606.ENSP00000312709	0.999	Transcription initiation factor TFIID subunit 7
5	9606.ENSP00000354633	0.999	Transcription initiation factor TFIID subunit 11
6	9606.ENSP00000355051	0.999	Transcription initiation factor TFIID subunit 13
7	9606.ENSP00000358854	0.999	Transcription initiation factor TFIID subunit 5
8	9606.ENSP00000367406	0.999	Transcription initiation factor TFIID subunit 2
9	9606.ENSP00000370193	0.999	Transcription initiation factor TFIID subunit 9
10	9606.ENSP00000375942	0.999	TATA-box-binding protein
11	9606.ENSP00000399982	0.999	Transcription initiation factor TFIID subunit 6
12	9606.ENSP00000406549	0.999	Transcription initiation factor TFIID subunit 1
13	9606.ENSP00000339917	0.991	Transcription initiation factor TFIID subunit 9B
14	9606.ENSP00000361998	0.981	Transcription initiation factor TFIID subunit 7-like
15	9606.ENSP00000379372	0.981	Transcription initiation factor IIA subunit 2
16	9606.ENSP00000452454	0.981	Transcription initiation factor IIA subunit 1
17	9606.ENSP00000340271	0.974	Transcription initiation factor TFIID subunit 3
18	9606.ENSP00000359531	0.964	Transcription initiation factor IIB
19	9606.ENSP00000269142	0.960	Transcription initiation factor TFIID subunit 4B
20	9606.ENSP00000348168	0.949	Transcription initiation factor IIE subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016251	1.000	RNA polymerase II general transcription initiation factor activity
GO:0005515	1.000	protein binding
GO:0097159	0.498	organic cyclic compound binding
GO:1901363	0.453	heterocyclic compound binding
GO:0003676	0.312	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0006351	0.977	DNA-templated transcription
GO:0050794	0.967	regulation of cellular process
GO:0019222	0.955	regulation of metabolic process
GO:0060255	0.953	regulation of macromolecule metabolic process
GO:0006352	0.947	DNA-templated transcription initiation
GO:0019219	0.945	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.936	regulation of gene expression
GO:0051252	0.936	regulation of RNA metabolic process
GO:0031326	0.935	regulation of cellular biosynthetic process
GO:0006355	0.934	regulation of DNA-templated transcription
GO:0070897	0.933	transcription preinitiation complex assembly
GO:0006357	0.918	regulation of transcription by RNA polymerase II
GO:0042789	0.912	mRNA transcription by RNA polymerase II
GO:0006367	0.905	transcription initiation at RNA polymerase II promoter
GO:0060261	0.903	positive regulation of transcription initiation by RNA polymerase II
GO:1901564	0.888	organonitrogen compound metabolic process
GO:0051123	0.888	RNA polymerase II preinitiation complex assembly
GO:0036211	0.871	protein modification process
GO:0051179	0.838	localization
GO:0016310	0.815	phosphorylation
GO:0034504	0.774	protein localization to nucleus
GO:0051651	0.739	maintenance of location in cell
GO:0032507	0.728	maintenance of protein location in cell
GO:0072595	0.724	maintenance of protein localization in organelle
GO:0006468	0.619	protein phosphorylation
GO:0051457	0.616	maintenance of protein location in nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016591	0.998	RNA polymerase II, holoenzyme
GO:0090575	0.988	RNA polymerase II transcription regulator complex
GO:0005737	0.983	cytoplasm
GO:0005669	0.978	transcription factor TFIID complex
GO:0043232	0.693	intracellular non-membrane-bounded organelle
GO:0048471	0.359	perinuclear region of cytoplasm
GO:0005694	0.339	chromosome
GO:0005829	0.322	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]