StarFunc result for job id Q7Z7D3

User Input

>input (282 residues)
MASLGQILFWSIISIIIILAGAIALIIGFGISGRHSITVTTVASAGNIGEDGILSCTFEP
DIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNV
QLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVV
WASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKV
TESEIKRRSHLQLLNSKASLCVSSFFAISWALLPLSPYLMLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z7D3	1.000	1.000	5.295E-53	282	1.000	1.000	Q7Z7D3.pdb.gz	VTCN1_HUMAN V-set domain-containing T-cell activation inhibitor 1 OS=Homo sapiens OX=9606 GN=VTCN1 PE=1 SV=1
2	AFDB:Q7TSP5	0.897	0.894	1.462E-46	283	0.855	0.852	Q7TSP5.pdb.gz	VTCN1_MOUSE V-set domain containing T-cell activation inhibitor 1 OS=Mus musculus OX=10090 GN=Vtcn1 PE=1 SV=1
3	AFDB:D4AE25	0.481	0.472	2.351E-17	290	0.216	0.210	D4AE25.pdb.gz	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
4	AFDB:Q9EP73	0.483	0.472	2.351E-17	290	0.206	0.200	Q9EP73.pdb.gz	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
5	AFDB:Q4QTK1	0.454	0.449	8.443E-17	287	0.199	0.195	Q4QTK1.pdb.gz	Q4QTK1_PIG CD274 molecule OS=Sus scrofa OX=9823 GN=CD274 PE=2 SV=1
6	AFDB:Q8VE98	0.451	0.412	8.443E-17	316	0.213	0.190	Q8VE98.pdb.gz	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
7	AFDB:Q9NZQ7	0.527	0.516	1.148E-16	290	0.181	0.176	Q9NZQ7.pdb.gz	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
8	AFDB:Q6UXE8	0.544	0.355	2.231E-16	466	0.206	0.124	Q6UXE8.pdb.gz	BTNL3_HUMAN Butyrophilin-like protein 3 OS=Homo sapiens OX=9606 GN=BTNL3 PE=1 SV=2
9	AFDB:O00478	0.467	0.267	4.565E-16	584	0.202	0.098	O00478.pdb.gz	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
10	AFDB:Q5ZPR3	0.462	0.275	8.875E-16	534	0.213	0.112	Q5ZPR3.pdb.gz	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
11	PDB:5c7kF	0.286	0.363	1.616E-9	212	0.124	0.165	5c7kF.pdb.gz	Complete epitopes for vaccine design derived from a crystal structure of the broadly neutralizing antibodies PGT128 and 8ANC195 in complex with an HIV-1 Env trimer.
12	PDB:3o3uN	0.382	0.214	2.985E-9	580	0.124	0.060	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
13	PDB:1n0xL	0.279	0.349	4.270E-9	215	0.124	0.163	1n0xL.pdb.gz	Crystal Structure of a Broadly Neutralizing Anti-HIV-1 Antibody in Complex with a Peptide Mimotope
14	PDB:1q0xL	0.286	0.361	4.978E-9	212	0.138	0.184	1q0xL.pdb.gz
15	PDB:1ngwH	0.318	0.403	6.428E-9	216	0.135	0.176	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
16	PDB:2qhrL	0.296	0.366	6.428E-9	218	0.142	0.183	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
17	PDB:1aifA	0.280	0.349	6.766E-9	215	0.124	0.163	1aifA.pdb.gz
18	PDB:1a8jL	0.264	0.330	7.121E-9	216	0.142	0.185	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
19	PDB:3bn9F	0.311	0.381	7.121E-9	224	0.117	0.147	3bn9F.pdb.gz
20	PDB:1uwxL	0.301	0.386	9.678E-9	211	0.110	0.147	1uwxL.pdb.gz	Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z7D3	0.0	579	282	1.000	1.000	VTCN1_HUMAN V-set domain-containing T-cell activation inhibitor 1 OS=Homo sapiens OX=9606 GN=VTCN1 PE=1 SV=1
2	Q7TSP5	1.14e-161	452	283	0.855	0.852	VTCN1_MOUSE V-set domain containing T-cell activation inhibitor 1 OS=Mus musculus OX=10090 GN=Vtcn1 PE=1 SV=1
3	Q5ZPR3	3.31e-20	92.4	534	0.230	0.122	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
4	Q8VE98	2.28e-19	88.2	316	0.238	0.212	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
5	Q6UXE8	5.72e-19	88.6	466	0.191	0.116	BTNL3_HUMAN Butyrophilin-like protein 3 OS=Homo sapiens OX=9606 GN=BTNL3 PE=1 SV=2
6	Q9UM44	2.84e-18	86.3	414	0.199	0.135	HHLA2_HUMAN HERV-H LTR-associating protein 2 OS=Homo sapiens OX=9606 GN=HHLA2 PE=1 SV=1
7	O00481	1.11e-17	84.7	513	0.170	0.094	BT3A1_HUMAN Butyrophilin subfamily 3 member A1 OS=Homo sapiens OX=9606 GN=BTN3A1 PE=1 SV=3
8	Q13410	1.18e-17	84.7	526	0.174	0.093	BT1A1_HUMAN Butyrophilin subfamily 1 member A1 OS=Homo sapiens OX=9606 GN=BTN1A1 PE=1 SV=3
9	Q6UX41	1.92e-17	84.0	500	0.220	0.124	BTNL8_HUMAN Butyrophilin-like protein 8 OS=Homo sapiens OX=9606 GN=BTNL8 PE=1 SV=1
10	P78410	6.62e-17	81.6	334	0.188	0.159	BT3A2_HUMAN Butyrophilin subfamily 3 member A2 OS=Homo sapiens OX=9606 GN=BTN3A2 PE=1 SV=2
11	O00478	1.30e-16	81.6	584	0.177	0.086	BT3A3_HUMAN Butyrophilin subfamily 3 member A3 OS=Homo sapiens OX=9606 GN=BTN3A3 PE=1 SV=1
12	D4AE25	2.81e-15	76.3	290	0.255	0.248	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
13	Q9EP73	3.42e-15	76.3	290	0.220	0.214	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
14	Q7KYR7	9.35e-13	70.1	527	0.131	0.070	BT2A1_HUMAN Butyrophilin subfamily 2 member A1 OS=Homo sapiens OX=9606 GN=BTN2A1 PE=1 SV=3
15	Q62556	2.21e-12	68.9	524	0.160	0.086	BT1A1_MOUSE Butyrophilin subfamily 1 member A1 OS=Mus musculus OX=10090 GN=Btn1a1 PE=1 SV=2
16	Q9UIR0	2.59e-12	68.9	455	0.184	0.114	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1
17	O70355	5.32e-12	67.8	454	0.135	0.084	BTNL2_MOUSE Butyrophilin-like protein 2 OS=Mus musculus OX=10090 GN=Btnl2 PE=1 SV=2
18	Q6UXG8	7.56e-12	67.4	535	0.131	0.069	BTNL9_HUMAN Butyrophilin-like protein 9 OS=Homo sapiens OX=9606 GN=BTNL9 PE=1 SV=1
19	Q9NZQ7	9.08e-12	66.2	290	0.195	0.190	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
20	Q8WVV5	1.13e-11	67.0	523	0.128	0.069	BT2A2_HUMAN Butyrophilin subfamily 2 member A2 OS=Homo sapiens OX=9606 GN=BTN2A2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	8.3e-05	33.9	Immunoglobulin I-set domain
2	PF00047 ig	0.13	23.8	Immunoglobulin domain
3	PF13895 Ig_2	0.00036	32.1	Immunoglobulin domain
4	PF13927 Ig_3	2.3e-07	42.6	Immunoglobulin domain
5	PF18452 Ig_6	1.7e+02	13.5	Immunoglobulin domain
6	PF07686 V-set	3.8e-07	41.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358470

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333919	0.979	B- and T-lymphocyte attenuator
2	9606.ENSP00000380855	0.811	Programmed cell death 1 ligand 2
3	9606.ENSP00000303939	0.747	Cytotoxic T-lymphocyte protein 4
4	9606.ENSP00000339477	0.710	Inducible T-cell co-stimulator ligand
5	9606.ENSP00000265362	0.709	Semaphorin-3A
6	9606.ENSP00000483732	0.709	ICOS ligand
7	9606.ENSP00000264246	0.677	T-lymphocyte activation antigen CD80
8	9606.ENSP00000332049	0.661	T-lymphocyte activation antigen CD86
9	9606.ENSP00000341637	0.637	Natural cytotoxicity triggering receptor 3 ligand 1
10	9606.ENSP00000479256	0.636	TLR4 interactor with leucine rich repeats
11	9606.ENSP00000312002	0.614	Hepatitis A virus cellular receptor 2
12	9606.ENSP00000203629	0.601	Lymphocyte activation gene 3 protein
13	9606.ENSP00000377001	0.576	Speckle-type POZ protein
14	9606.ENSP00000324890	0.575	T-cell-specific surface glycoprotein CD28
15	9606.ENSP00000301272	0.563	Transmembrane and immunoglobulin domain-containing protein 2
16	9606.ENSP00000386559	0.562	T-cell surface glycoprotein CD8 alpha chain
17	9606.ENSP00000412237	0.551	Interleukin-10
18	9606.ENSP00000011653	0.527	T-cell surface glycoprotein CD4
19	9606.ENSP00000335062	0.523	Programmed cell death protein 1
20	9606.ENSP00000430950	0.515	Indoleamine 2,3-dioxygenase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032944	0.997	regulation of mononuclear cell proliferation
GO:0050863	0.997	regulation of T cell activation
GO:1903037	0.995	regulation of leukocyte cell-cell adhesion
GO:0042129	0.992	regulation of T cell proliferation
GO:0048519	0.987	negative regulation of biological process
GO:0048523	0.972	negative regulation of cellular process
GO:0051250	0.956	negative regulation of lymphocyte activation
GO:0022408	0.955	negative regulation of cell-cell adhesion
GO:1903038	0.951	negative regulation of leukocyte cell-cell adhesion
GO:0050868	0.913	negative regulation of T cell activation
GO:0048518	0.907	positive regulation of biological process
GO:0048522	0.885	positive regulation of cellular process
GO:0019222	0.876	regulation of metabolic process
GO:0050896	0.862	response to stimulus
GO:0060255	0.855	regulation of macromolecule metabolic process
GO:0010468	0.769	regulation of gene expression
GO:0009893	0.752	positive regulation of metabolic process
GO:0045785	0.751	positive regulation of cell adhesion
GO:0001817	0.733	regulation of cytokine production
GO:0002684	0.691	positive regulation of immune system process
GO:0022409	0.669	positive regulation of cell-cell adhesion
GO:0051251	0.669	positive regulation of lymphocyte activation
GO:0009987	0.666	cellular process
GO:1903039	0.663	positive regulation of leukocyte cell-cell adhesion
GO:0050870	0.649	positive regulation of T cell activation
GO:0010604	0.633	positive regulation of macromolecule metabolic process
GO:0010941	0.598	regulation of cell death
GO:0008284	0.495	positive regulation of cell population proliferation
GO:0010628	0.492	positive regulation of gene expression
GO:0008285	0.474	negative regulation of cell population proliferation
GO:0042981	0.472	regulation of apoptotic process
GO:0032945	0.450	negative regulation of mononuclear cell proliferation
GO:0001819	0.449	positive regulation of cytokine production
GO:0050672	0.436	negative regulation of lymphocyte proliferation
GO:0070665	0.411	positive regulation of leukocyte proliferation
GO:0050671	0.360	positive regulation of lymphocyte proliferation
GO:0060548	0.353	negative regulation of cell death
GO:0002376	0.343	immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.987	cell surface
GO:0098552	0.819	side of membrane
GO:0009897	0.801	external side of plasma membrane
GO:0043226	0.553	organelle
GO:0005622	0.446	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]