StarFunc result for job id Q7Z7G0

User Input

>input (1075 residues)
MRGGKCNMLSSLGCLLLCGSITLALGNAQKLPKGKRPNLKVHINTTSDSILLKFLRPSPN
VKLEGLLLGYGSNVSPNQYFPLPAEGKFTEAIVDAEPKYLIVVRPAPPPSQKKSCSGKTR
SRKPLQLVVGTLTPSSVFLSWGFLINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQI
CPATETIVENLKPNTVYEFGVKDNVEGGIWSKIFNHKTVVGSKKVNGKIQSTYDQDHTVP
AYVPRKLIPITIIKQVIQNVTHKDSAKSPEKAPLGGVILVHLIIPGLNETTVKLPASLMF
EISDALKTQLAKNETLALPAESKTPEVEKISARPTTVTPETVPRSTKPTTSSALDVSETT
LASSEKPWIVPTAKISEDSKVLQPQTATYDVFSSPTTSDEPEISDSYTATSDRILDSIPP
KTSRTLEQPRATLAPSETPFVPQKLEIFTSPEMQPTTPAPQQTTSIPSTPKRRPRPKPPR
TKPERTTSAGTITPKISKSPEPTWTTPAPGKTQFISLKPKIPLSPEVTHTKPAPKQTPRA
PPKPKTSPRPRIPQTQPVPKVPQRVTAKPKTSPSPEVSYTTPAPKDVLLPHKPYPEVSQS
EPAPLETRGIPFIPMISPSPSQEELQTTLEETDQSTQEPFTTKIPRTTELAKTTQAPHRF
YTTVRPRTSDKPHIRPGVKQAPRPSGADRNVSVDSTHPTKKPGTRRPPLPPRPTHPRRKP
LPPNNVTGKPGSAGIISSGPITTPPLRSTPRPTGTPLERIETDIKQPTVPASGEELENIT
DFSSSPTRETDPLGKPRFKGPHVRYIQKPDNSPCSITDSVKRFPKEEATEGNATSPPQNP
PTNLTVVTVEGCPSFVILDWEKPLNDTVTEYEVISRENGSFSGKNKSIQMTNQTFSTVEN
LKPNTSYEFQVKPKNPLGEGPVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYS
ECKGKQYVKRTWYKKFVGVQLCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFL
DGRTGQQLTSDQLPIKEGYFRAVRQEPVQFGEIGGHTQINYVQWYECGTTIPGKW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q59IW6	0.192	0.180	0.000	1179	0.788	0.718	Q59IW6.pdb.gz	Q59IW6_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
2	AFDB:Q59IW9	0.201	0.200	0.000	1079	0.761	0.758	Q59IW9.pdb.gz	Q59IW9_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
3	AFDB:Q7Z7G0	1.000	1.000	0.000	1075	1.000	1.000	Q7Z7G0.pdb.gz	TARSH_HUMAN Target of Nesh-SH3 OS=Homo sapiens OX=9606 GN=ABI3BP PE=1 SV=2
4	AFDB:Q59IW5	0.187	0.182	4.766E-102	1115	0.767	0.739	Q59IW5.pdb.gz	Q59IW5_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
5	AFDB:A0A338P6S8	0.285	0.197	7.470E-98	1637	0.791	0.519	A0A338P6S8.pdb.gz	A0A338P6S8_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
6	AFDB:A0A338P6W9	0.213	0.250	1.684E-93	884	0.657	0.799	A0A338P6W9.pdb.gz	A0A338P6W9_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
7	AFDB:Q2Q0I9	0.273	0.170	2.158E-36	1779	0.329	0.199	Q2Q0I9.pdb.gz	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
8	AFDB:B7YZW3	0.086	0.047	7.590E-7	2064	0.144	0.075	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
9	AFDB:A0A2R8QRK0	0.091	0.071	4.592E-5	1420	0.127	0.096	A0A2R8QRK0.pdb.gz	A0A2R8QRK0_DANRE Roundabout homolog 3 isoform X3 OS=Danio rerio OX=7955 GN=cb503 PE=1 SV=1
10	AFDB:Q96MS0	0.080	0.064	9.501E-5	1386	0.114	0.089	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
11	PDB:6xi2A	0.082	0.163	1.874E-4	528	0.025	0.051	6xi2A.pdb.gz	Crystal structures of beta-1,4-N-acetylglucosaminyltransferase 2: structural basis for inherited muscular dystrophies.
12	PDB:6pyhD	0.087	0.116	5.577E-4	798	0.034	0.046	6pyhD.pdb.gz
13	PDB:7u7nC	0.076	0.355	5.875E-4	200	0.029	0.155	7u7nC.pdb.gz
14	PDB:3csbA	0.075	0.163	6.518E-4	464	0.020	0.047	3csbA.pdb.gz	A Dominant Conformational Role for Amino Acid Diversity in Minimalist Protein-Protein Interfaces
15	PDB:8dtlA	0.082	0.117	9.875E-4	741	0.024	0.035	8dtlA.pdb.gz
16	PDB:7bwaA	0.074	0.113	1.348E-3	674	0.031	0.049	7bwaA.pdb.gz
17	PDB:6pxvA	0.083	0.106	2.152E-3	823	0.024	0.032	6pxvA.pdb.gz
18	PDB:8eyyA	0.078	0.106	2.267E-3	775	0.033	0.045	8eyyA.pdb.gz
19	PDB:5iv5BJ	0.075	0.080	3.260E-3	1004	0.032	0.034	5iv5BJ.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
20	PDB:7z0lB	0.069	0.178	1.134E-2	370	0.027	0.078	7z0lB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A338P6S8	0.0	771	1637	0.390	0.256	A0A338P6S8_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
2	A0A338P6W9	0.0	589	884	0.314	0.382	A0A338P6W9_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
3	B2RWZ0	0.0	585	884	0.313	0.380	B2RWZ0_MOUSE Abi3bp protein OS=Mus musculus OX=10090 GN=Abi3bp PE=2 SV=1
4	E9Q8E3	0.0	627	909	0.333	0.394	E9Q8E3_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
5	F1M0R2	0.0	1625	1174	0.793	0.726	F1M0R2_RAT ABI family member 3 binding protein OS=Rattus norvegicus OX=10116 GN=Abi3bp PE=1 SV=4
6	Q59IW5	0.0	1545	1115	0.763	0.735	Q59IW5_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
7	Q59IW6	0.0	1608	1179	0.793	0.723	Q59IW6_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
8	Q59IW7	0.0	1554	1099	0.763	0.746	Q59IW7_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
9	Q59IW8	0.0	625	909	0.332	0.393	Q59IW8_MOUSE Target of Nesh-SH3 variant 3 OS=Mus musculus OX=10090 GN=Abi3bp PE=2 SV=1
10	Q59IW9	0.0	1528	1079	0.753	0.750	Q59IW9_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1
11	Q7Z7G0	0.0	2149	1068	0.993	1.000	TARSH_HUMAN Target of Nesh-SH3 OS=Homo sapiens OX=9606 GN=ABI3BP PE=1 SV=2
12	Q8BKQ1	0.0	616	371	0.279	0.809	Q8BKQ1_MOUSE Fibronectin type-III domain-containing protein OS=Mus musculus OX=10090 GN=Abi3bp PE=2 SV=1
13	Q8BUA2	0.0	763	528	0.361	0.735	Q8BUA2_MOUSE Fibronectin type-III domain-containing protein OS=Mus musculus OX=10090 GN=Abi3bp PE=2 SV=1
14	Q8R0M1	0.0	705	438	0.328	0.806	Q8R0M1_MOUSE Abi3bp protein (Fragment) OS=Mus musculus OX=10090 GN=Abi3bp PE=2 SV=1
15	Q8BLU9	3.28e-89	285	159	0.126	0.849	Q8BLU9_MOUSE Target of Nesh-SH3 (Fragment) OS=Mus musculus OX=10090 GN=Abi3bp PE=2 SV=2
16	Q2Q0I9	1.59e-85	306	1779	0.151	0.091	FNDC1_RAT Fibronectin type III domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Fndc1 PE=1 SV=2
17	Q4ZHG4	2.25e-85	306	1894	0.147	0.083	FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FNDC1 PE=2 SV=4
18	J3KNQ2	3.07e-85	305	1790	0.147	0.088	J3KNQ2_HUMAN Fibronectin type III domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=FNDC1 PE=1 SV=1
19	A0A0R4IP15	3.01e-05	50.8	1428	0.031	0.023	A0A0R4IP15_DANRE Neogenin 1a OS=Danio rerio OX=7955 GN=cb333 PE=1 SV=1
20	Q92859	3.02e-05	50.8	1461	0.029	0.021	NEO1_HUMAN Neogenin OS=Homo sapiens OX=9606 GN=NEO1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	2.8e-11	54.9	Fibronectin type III domain
2	PF09294 Interfer-bind	0.45	22.2	Interferon-alpha/beta receptor, fibronectin type III
3	PF10179 NDNF	2.6e+02	13.1	Neuron-derived neurotrophic factor, first Fn(III) domain
4	PF16656 Pur_ac_phosph_N	0.0016	30.4	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284322

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225941	0.973	ABI gene family member 3
2	9606.ENSP00000365312	0.648	Abl interactor 1
3	9606.ENSP00000363452	0.530	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005518	1.000	collagen binding
GO:0008201	1.000	heparin binding
GO:0005515	0.805	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0045785	0.966	positive regulation of cell adhesion
GO:0030198	0.964	extracellular matrix organization
GO:0010811	0.957	positive regulation of cell-substrate adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0005576	0.962	extracellular region
GO:0005615	0.898	extracellular space
GO:0012505	0.526	endomembrane system
GO:0043227	0.461	membrane-bounded organelle
GO:0005614	0.406	interstitial matrix
GO:0005622	0.396	intracellular anatomical structure
GO:0005737	0.392	cytoplasm
GO:0043231	0.372	intracellular membrane-bounded organelle
GO:0016020	0.353	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]