StarFunc result for job id Q7Z7G1

User Input

>input (428 residues)
MNRQGNRKTTKEGSNDLKFQNFSLPKNRSWPRINSATGQYQRMNKPLLDWERNFAAVLDG
AKGHSDDDYDDPELRMEETWQSIKILPARPIKESEYADTHYFKVAMDTPLPLDTRTSISI
GQPTWNTQTRLERVDKPISKDVRSQNIKGDASVRKNKIPLPPPRPLITLPKKYQPLPPEP
ESSRPPLSQRHTFPEVQRMPSQISLRDLSEVLEAEKVPHNQRKPESTHLLENQNTQEIPL
AISSSSFTTSNHSVQNRDHRGGMQPCSPQRCQPPASCSPHENILPYKYTSWRPPFPKRSD
RKDVQHNEWYIGEYSRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFYENKVYNVK
IRFLERNQQFALGTGLRGDEKFDSVEDIIEHYKNFPIILIDGKDKTGVHRKQCHLTQPLP
LTRHLLPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z7G1	0.999	0.999	7.999E-67	428	1.000	1.000	Q7Z7G1.pdb.gz	CLNK_HUMAN Cytokine-dependent hematopoietic cell linker OS=Homo sapiens OX=9606 GN=CLNK PE=1 SV=2
2	AFDB:Q9QZE2	0.289	0.284	3.792E-39	435	0.617	0.607	Q9QZE2.pdb.gz	CLNK_MOUSE Cytokine-dependent hematopoietic cell linker OS=Mus musculus OX=10090 GN=Clnk PE=1 SV=1
3	AFDB:Q9DG07	0.267	0.218	2.426E-16	530	0.248	0.200	Q9DG07.pdb.gz	Q9DG07_CHICK SLP-76 adaptor protein OS=Gallus gallus OX=9031 GN=SLP76 PE=1 SV=1
4	AFDB:Q9YGC1	0.261	0.204	9.015E-15	552	0.241	0.187	Q9YGC1.pdb.gz	BLNK_CHICK B-cell linker protein OS=Gallus gallus OX=9031 GN=BLNK PE=1 SV=1
5	AFDB:Q9JLY0	0.230	0.187	6.387E-7	533	0.208	0.167	Q9JLY0.pdb.gz	SOCS6_MOUSE Suppressor of cytokine signaling 6 OS=Mus musculus OX=10090 GN=Socs6 PE=1 SV=2
6	PDB:1ka6A	0.188	0.690	1.349E-6	107	0.047	0.187	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
7	PDB:4gwfA	0.222	0.192	1.434E-6	497	0.084	0.072	4gwfA.pdb.gz
8	AFDB:O14544	0.226	0.184	1.810E-6	535	0.157	0.125	O14544.pdb.gz	SOCS6_HUMAN Suppressor of cytokine signaling 6 OS=Homo sapiens OX=9606 GN=SOCS6 PE=1 SV=2
9	PDB:3ps5A	0.201	0.164	6.242E-6	529	0.065	0.053	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
10	PDB:8dcxB	0.186	0.327	6.242E-6	236	0.077	0.140	8dcxB.pdb.gz
11	PDB:7myoB	0.192	0.279	7.501E-6	286	0.079	0.119	7myoB.pdb.gz	Cryo-EM structures of PI3K alpha reveal conformational changes during inhibition and activation.
12	PDB:5xzrA	0.214	0.178	8.479E-6	519	0.082	0.067	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
13	PDB:4fl2A	0.201	0.158	1.384E-5	555	0.063	0.049	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:2lqnA	0.190	0.264	2.555E-5	303	0.079	0.112	2lqnA.pdb.gz
15	PDB:1griA	0.190	0.374	5.666E-5	211	0.047	0.095	1griA.pdb.gz
16	PDB:4k2rA	0.205	0.161	1.421E-4	551	0.058	0.045	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
17	AFDB:Q63HR2	0.175	0.056	4.081E-3	1409	0.159	0.048	Q63HR2.pdb.gz	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
18	AFDB:Q04205	0.169	0.044	9.623E-3	1744	0.147	0.036	Q04205.pdb.gz	TENS1_CHICK Tensin-1 OS=Gallus gallus OX=9031 GN=TNS1 PE=1 SV=3
19	AFDB:A1Z951	0.072	0.058	2.134E-2	639	0.129	0.086	A1Z951.pdb.gz	A1Z951_DROME MIP12871p OS=Drosophila melanogaster OX=7227 GN=CG12488 PE=2 SV=2
20	AFDB:Q9HBL0	0.182	0.048	4.188E-2	1735	0.159	0.039	Q9HBL0.pdb.gz	TENS1_HUMAN Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z7G1	0.0	889	428	1.000	1.000	CLNK_HUMAN Cytokine-dependent hematopoietic cell linker OS=Homo sapiens OX=9606 GN=CLNK PE=1 SV=2
2	Q9QZE2	1.35e-178	507	435	0.621	0.611	CLNK_MOUSE Cytokine-dependent hematopoietic cell linker OS=Mus musculus OX=10090 GN=Clnk PE=1 SV=1
3	Q13094	5.95e-30	124	533	0.138	0.111	LCP2_HUMAN Lymphocyte cytosolic protein 2 OS=Homo sapiens OX=9606 GN=LCP2 PE=1 SV=1
4	Q9DG07	7.91e-30	123	530	0.133	0.108	Q9DG07_CHICK SLP-76 adaptor protein OS=Gallus gallus OX=9031 GN=SLP76 PE=1 SV=1
5	Q60787	8.33e-30	123	533	0.131	0.105	LCP2_MOUSE Lymphocyte cytosolic protein 2 OS=Mus musculus OX=10090 GN=Lcp2 PE=1 SV=2
6	Q9YGC1	6.77e-24	106	552	0.103	0.080	BLNK_CHICK B-cell linker protein OS=Gallus gallus OX=9031 GN=BLNK PE=1 SV=1
7	Q8WV28	1.01e-23	105	456	0.100	0.094	BLNK_HUMAN B-cell linker protein OS=Homo sapiens OX=9606 GN=BLNK PE=1 SV=2
8	Q9QUN3	1.38e-22	101	457	0.096	0.090	BLNK_MOUSE B-cell linker protein OS=Mus musculus OX=10090 GN=Blnk PE=1 SV=1
9	S6CMQ2	3.67e-09	61.2	590	0.105	0.076	S6CMQ2_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=shp3 PE=2 SV=1
10	Q7SY37	1.05e-08	59.7	592	0.103	0.074	Q7SY37_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=zgc:63553 PE=2 SV=1
11	P29349	1.46e-08	59.3	845	0.086	0.044	CSW_DROME Tyrosine-protein phosphatase corkscrew OS=Drosophila melanogaster OX=7227 GN=csw PE=1 SV=2
12	O54737	2.86e-06	52.0	516	0.044	0.037	O54737_MOUSE BCA protein (Fragment) OS=Mus musculus OX=10090 GN=Blnk PE=1 SV=1
13	W5UIG7	5.18e-06	51.2	1118	0.075	0.029	W5UIG7_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=Inpp5d PE=2 SV=1
14	A0A0C5AMM3	5.27e-06	51.2	1116	0.075	0.029	A0A0C5AMM3_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 PE=2 SV=1
15	Q7ZW17	6.28e-06	50.8	594	0.093	0.067	Q7ZW17_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn11 PE=1 SV=1
16	Q9XYM0	6.99e-06	49.7	271	0.070	0.111	CRK_DROME Adapter molecule Crk OS=Drosophila melanogaster OX=7227 GN=Crk PE=1 SV=1
17	F1N339	1.40e-05	49.7	593	0.093	0.067	F1N339_BOVIN Tyrosine-protein phosphatase non-receptor type OS=Bos taurus OX=9913 GN=PTPN11 PE=3 SV=3
18	Q63787	1.70e-05	49.7	724	0.075	0.044	P85A_RAT Phosphatidylinositol 3-kinase regulatory subunit alpha OS=Rattus norvegicus OX=10116 GN=Pik3r1 PE=1 SV=1
19	P41499	1.93e-05	49.3	593	0.093	0.067	PTN11_RAT Tyrosine-protein phosphatase non-receptor type 11 OS=Rattus norvegicus OX=10116 GN=Ptpn11 PE=1 SV=5
20	Q92835	1.97e-05	49.7	1189	0.086	0.031	SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16457 PH_12	1.5e+02	14.3	Pleckstrin homology domain
2	PF00017 SH2	2.3e-11	54.9	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226951

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378845	0.661	Linker for activation of T cells
2	9606.ENSP00000427114	0.638	FYN-binding protein 1
3	9606.ENSP00000323435	0.617	Sorting nexin-22
4	9606.ENSP00000428924	0.564	Tyrosine-protein kinase Lyn
5	9606.ENSP00000346671	0.549	Tyrosine-protein kinase Fyn
6	9606.ENSP00000457421	0.536	Platelet endothelial cell adhesion molecule
7	9606.ENSP00000215882	0.528	Tricarboxylate transport protein, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.397	signaling receptor binding
GO:0019899	0.343	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.989	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0002376	0.984	immune system process
GO:0048584	0.982	positive regulation of response to stimulus
GO:0050776	0.978	regulation of immune response
GO:0002684	0.977	positive regulation of immune system process
GO:0050896	0.975	response to stimulus
GO:0050778	0.963	positive regulation of immune response
GO:0051239	0.933	regulation of multicellular organismal process
GO:0007165	0.920	signal transduction
GO:0060255	0.890	regulation of macromolecule metabolic process
GO:0006810	0.862	transport
GO:0032501	0.845	multicellular organismal process
GO:0048519	0.818	negative regulation of biological process
GO:0007166	0.791	cell surface receptor signaling pathway
GO:0009893	0.780	positive regulation of metabolic process
GO:0010604	0.614	positive regulation of macromolecule metabolic process
GO:0048523	0.598	negative regulation of cellular process
GO:0016192	0.582	vesicle-mediated transport
GO:0010468	0.528	regulation of gene expression
GO:0002694	0.419	regulation of leukocyte activation
GO:0002252	0.412	immune effector process
GO:0006955	0.410	immune response
GO:0048522	0.390	positive regulation of cellular process
GO:0051249	0.365	regulation of lymphocyte activation
GO:0051240	0.364	positive regulation of multicellular organismal process
GO:0002683	0.337	negative regulation of immune system process
GO:0007169	0.332	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0032418	0.304	lysosome localization
GO:0045321	0.303	leukocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043227	0.962	membrane-bounded organelle
GO:0043229	0.962	intracellular organelle
GO:0043231	0.940	intracellular membrane-bounded organelle
GO:0071944	0.732	cell periphery
GO:0005886	0.722	plasma membrane
GO:0032991	0.648	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]