StarFunc result for job id Q7Z7G8

User Input

>input (1400 residues)
MLESYVTPILMSYVNRYIKNLKPSDLQLSLWGGDVVLSKLELKLDVLEQELKLPFTFLSG
HIHELRIHVPWTKLGSEPVVITINTMECILKLKDGIQDDHESCGSNSTNRSTAESTKSSI
KPRRMQQAAPTDPDLPPGYVQSLIRRVVNNVNIVINNLILKYVEDDIVLSVNITSAECYT
VGELWDRAFMDISATDLVLRKVINFSDCTVCLDKRNASGKIEFYQDPLLYKCSFRTRLHF
TYENLNSKMPSVIKIHTLVESLKLSITDQQLPMFIRIMQLGIALYYGEIGNFKEGEIEDL
TCHNKDMLGNITGSEDETRIDMQYPAQHKGQELYSQQDEEQPQGWVSWAWSFVPAIVSYD
DGEEDFVGNDPASTMHQQKAQTLKDPIVSIGFYCTKATVTFKLTEMQVESSYYSPQKVKS
KEVLCWEQEGTTVEALMMGEPFFDCQIGFVGCRAMCLKGIMGVKDFEENMNRSETEACFF
ICGDNLSTKGFTYLTNSLFDYRSPENNGTRAEFILDSTHHKETYTEIAGMQRFGAFYMDY
LYTMENTSGKGSTNQQDFSSGKSEDLGTVQEKSTKSLVIGPLDFRLDSSAVHRILKMIVC
ALEHEYEPYSRLKSDIKDENETILNPEEVALLEEYIPTRHTSVTLLKCTCTISMAEFNLL
DHLLPVIMGEKNSSNFMNTTNFQSLRPLPSIRILVDKINLEHSVPMYAEQLVHVVSSLTQ
PSDNLLHYCYVHCYLKIFGFQAGLTSLDCSGSYCLPVPVIPSFSTALYGKLLKLPTCWTK
RSQIAITEGIFELPNLTIQATRAQTLLLQAIYQSWSHLGNVSSSAVIEALINEIFLSIGV
KSKNPLPTLEGSIQNVELKYCSTSLVKCASGTMGSIKICAKAPVDSGKEKLIPLLQGPSD
TKDLHSTKWLNESRKPESLLAPDLMAFTIQVPQYIDYCHNSGAVLLCSIQGLAVNIDPIL
YTWLIYQPQKRTSRHMQQQPVVAVPLVMPVCRRKEDEVSIGSAPLAKQQSYQASEYASSP
VKTKTVTESRPLSVPVKAMLNISESCRSPEERMKEFIGIVWNAVKHLTLQLEVQSCCVFI
PNDSLPSPSTIVSGDIPGTVRSWYHGQTSMPGTLVLCLPQIKIISAGHKYMEPLQEIPFV
IPRPILEEGDAFPWTISLHNFSIYTLLGKQVTLCLVEPMGCTSTLAVTSQKLLATGPDTR
HSFVVCLHVDLESLEIKCSNPQVQLFYELTDIMNKVWNKIQKRGNLNLSPTSPETMAGPV
PTSPVRSSIGTAPPDTSTCSPSADIGTTTEGDSIQAGEESPFSDSVTLEQTTSNIGGTSG
RVSLWMQWVLPKITIKLFAPDPENKGTEVCMVSELEDLSASIDVQDVYTKVKCKIESFNI
DHYRSSLGEECWSLGQCGGV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8S296	0.352	0.276	4.214E-39	1892	0.124	0.091	F8S296.pdb.gz	ATG2_ARATH Autophagy-related protein 2 OS=Arabidopsis thaliana OX=3702 GN=ATG2 PE=2 SV=1
2	AFDB:Q9VZX7	0.200	0.157	5.372E-37	1906	0.123	0.090	Q9VZX7.pdb.gz	Q9VZX7_DROME Autophagy-related 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Atg2 PE=2 SV=1
3	AFDB:Q2TAZ0	0.351	0.267	5.458E-36	1938	0.116	0.084	Q2TAZ0.pdb.gz	ATG2A_HUMAN Autophagy-related protein 2 homolog A OS=Homo sapiens OX=9606 GN=ATG2A PE=1 SV=3
4	AFDB:Q96BY7	0.373	0.267	2.038E-35	2078	0.115	0.077	Q96BY7.pdb.gz	ATG2B_HUMAN Autophagy-related protein 2 homolog B OS=Homo sapiens OX=9606 GN=ATG2B PE=1 SV=5
5	AFDB:K7VLR4	0.225	0.134	5.378E-27	2605	0.084	0.045	K7VLR4.pdb.gz	APT1_MAIZE Protein ABERRANT POLLEN TRANSMISSION 1 OS=Zea mays OX=4577 GN=APT1 PE=2 SV=1
6	AFDB:Q6IMT0	0.299	0.185	1.143E-25	2587	0.094	0.051	Q6IMT0.pdb.gz	KIP_ARATH Protein KINKY POLLEN OS=Arabidopsis thaliana OX=3702 GN=KIP PE=2 SV=1
7	AFDB:Q8T620	0.190	0.213	3.246E-19	1192	0.079	0.093	Q8T620.pdb.gz	Q8T620_DROME Bridge-like lipid transfer protein family member 1 C-terminal domain-containing protein OS=Drosophila melanogaster OX=7227 GN=tweek PE=4 SV=1
8	AFDB:W0RYD3	0.079	0.063	2.166E-8	2135	0.074	0.049	W0RYD3.pdb.gz	SSG4_ORYSJ Protein SUBSTANDARD STARCH GRAIN 4, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SSG4 PE=1 SV=1
9	PDB:6a9eA	0.090	0.350	1.225E-5	339	0.019	0.080	6a9eA.pdb.gz
10	AFDB:Q382B3	0.044	0.052	2.297E-1	1061	0.079	0.105	Q382B3.pdb.gz	Q382B3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5850 PE=4 SV=1
11	PDB:6ofrA	0.076	0.116	2.458E-1	758	0.032	0.059	6ofrA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
12	AFDB:Q94A41	0.030	0.043	2.836E-1	887	0.044	0.069	Q94A41.pdb.gz	AMY3_ARATH Alpha-amylase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=AMY3 PE=1 SV=1
13	PDB:7lpsA	0.056	0.082	4.625E-1	781	0.046	0.082	7lpsA.pdb.gz	Acute pharmacological degradation of Helios destabilizes regulatory T cells.
14	PDB:4o9yA	0.027	0.019	4.875E-1	2490	0.016	0.009	4o9yA.pdb.gz
15	PDB:6bpnA	0.068	0.116	5.417E-1	656	0.030	0.064	6bpnA.pdb.gz	The structure of the bacterial iron-catecholate transporter Fiu suggests that it imports substrates via a two-step mechanism.
16	PDB:6x08A	0.029	0.085	5.710E-1	310	0.015	0.068	6x08A.pdb.gz
17	PDB:6e4vA	0.063	0.103	6.019E-1	672	0.039	0.082	6e4vA.pdb.gz	Determination of the molecular basis for coprogen import by Gram-negative bacteria.
18	PDB:7dvq3	0.027	0.030	7.050E-1	1193	0.021	0.025	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:7n9sA	0.037	0.027	8.704E-1	2365	0.016	0.009	7n9sA.pdb.gz
20	PDB:7nacA	0.029	0.083	8.704E-1	266	0.022	0.117	7nacA.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z7G8	0.0	2905	4022	1.000	0.348	VP13B_HUMAN Intermembrane lipid transfer protein VPS13B OS=Homo sapiens OX=9606 GN=VPS13B PE=1 SV=2
2	Q80TY5	0.0	2556	3993	0.888	0.311	VP13B_MOUSE Intermembrane lipid transfer protein VPS13B OS=Mus musculus OX=10090 GN=Vps13b PE=1 SV=3
3	A1Z713	2.16e-17	91.3	3321	0.039	0.017	VPS13_DROME Intermembrane lipid transfer protein Vps13 OS=Drosophila melanogaster OX=7227 GN=Vps13 PE=1 SV=2
4	G0S3B8	3.89e-15	84.0	3225	0.041	0.018	VPS13_CHATD Intermembrane lipid transfer protein VPS13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=VPS13 PE=1 SV=1
5	F4JNE2	3.98e-14	80.5	4219	0.034	0.011	F4JNE2_ARATH Pleckstrin homology (PH) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=DL4605C PE=1 SV=1
6	Q54KX3	3.42e-12	74.3	4246	0.025	0.008	VP13F_DICDI Intermembrane lipid transfer protein vps13F OS=Dictyostelium discoideum OX=44689 GN=vps13F PE=3 SV=1
7	F4KIH9	4.04e-12	73.9	3464	0.034	0.014	F4KIH9_ARATH Vacuolar protein sorting-associated protein, putative (DUF1162) OS=Arabidopsis thaliana OX=3702 GN=SHBY PE=1 SV=1
8	Q5H8C4	2.73e-11	71.2	3166	0.038	0.017	VP13A_MOUSE Intermembrane lipid transfer protein VPS13A OS=Mus musculus OX=10090 GN=Vps13a PE=1 SV=1
9	Q9FT44	5.37e-11	70.5	3306	0.025	0.011	Q9FT44_ARATH VPS13-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g24740 PE=3 SV=1
10	Q96RL7	8.22e-11	69.7	3174	0.036	0.016	VP13A_HUMAN Intermembrane lipid transfer protein VPS13A OS=Homo sapiens OX=9606 GN=VPS13A PE=1 SV=2
11	F4HWS2	1.37e-10	68.9	4146	0.034	0.012	F4HWS2_ARATH Calcium-dependent lipid-binding family protein OS=Arabidopsis thaliana OX=3702 GN=At1g48090 PE=1 SV=1
12	Q8BX70	1.42e-10	68.9	3748	0.026	0.010	VP13C_MOUSE Intermembrane lipid transfer protein VPS13C OS=Mus musculus OX=10090 GN=Vps13c PE=1 SV=2
13	A0A0D9RI63	1.62e-10	68.9	3754	0.026	0.010	A0A0D9RI63_CHLSB Vacuolar protein sorting 13 homolog C OS=Chlorocebus sabaeus OX=60711 GN=VPS13C PE=3 SV=1
14	Q07878	2.05e-10	68.6	3144	0.044	0.019	VPS13_YEAST Intermembrane lipid transfer protein VPS13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS13 PE=1 SV=1
15	Q709C8	2.43e-10	68.2	3753	0.024	0.009	VP13C_HUMAN Intermembrane lipid transfer protein VPS13C OS=Homo sapiens OX=9606 GN=VPS13C PE=1 SV=1
16	Q5THJ4	1.88e-09	65.1	4388	0.034	0.011	VP13D_HUMAN Intermembrane lipid transfer protein VPS13D OS=Homo sapiens OX=9606 GN=VPS13D PE=1 SV=2
17	P87319	1.89e-07	58.5	3011	0.031	0.015	VP13A_SCHPO Intermembrane lipid transfer protein vps1301 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps1301 PE=3 SV=2
18	Q57X24	5.90e-07	57.0	4810	0.025	0.007	Q57X24_TRYB2 Peroxin/Ferlin domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.190 PE=3 SV=1
19	Q9VU08	2.52e-06	55.1	3919	0.029	0.010	VP13D_DROME Intermembrane lipid transfer protein Vps13D OS=Drosophila melanogaster OX=7227 GN=Vps13D PE=1 SV=3
20	Q6BDS2	3.28e-06	54.3	1440	0.042	0.041	BLT3A_HUMAN Bridge-like lipid transfer protein family member 3A OS=Homo sapiens OX=9606 GN=BLTP3A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12624 Chorein_N	1e-23	95.0	N-terminal region of Chorein or VPS13
2	PF16908 VPS13	0.46	21.7	Vacuolar sorting-associated protein 13, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351346

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311449	0.800	Ras-related protein Rab-6A
2	9606.ENSP00000278243	0.710	Post-GPI attachment to proteins factor 2
3	9606.ENSP00000438553	0.689	Histone H2A.J
4	9606.ENSP00000274569	0.679	Prenylcysteine oxidase-like
5	9606.ENSP00000281828	0.661	phenylalanyl-tRNA synthetase beta subunit
6	9606.ENSP00000290607	0.660	StAR-related lipid transfer protein 9
7	9606.ENSP00000348673	0.649	Zinc finger protein 770
8	9606.ENSP00000350708	0.649	UV excision repair protein RAD23 homolog B
9	9606.ENSP00000261435	0.626	NEDD4-binding protein 2
10	9606.ENSP00000215882	0.625	Tricarboxylate transport protein, mitochondrial
11	9606.ENSP00000358335	0.596	Mitogen-activated protein kinase kinase kinase 7
12	9606.ENSP00000475594	0.583	Zinc finger protein 462
13	9606.ENSP00000277225	0.581	Zinc finger protein 462
14	9606.ENSP00000261514	0.563	H(+)/Cl(-) exchange transporter 3
15	9606.ENSP00000332194	0.557	Histone H2A type 2-C
16	9606.ENSP00000450857	0.555	Stonin-2
17	9606.ENSP00000346027	0.551	60S ribosomal protein L21
18	9606.ENSP00000338276	0.549	Cysteine-rich secretory protein 1
19	9606.ENSP00000372445	0.546	Methyltransferase-like protein 17, mitochondrial
20	9606.ENSP00000255194	0.542	AP-3 complex subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032266	1.000	phosphatidylinositol-3-phosphate binding
GO:0005515	0.949	protein binding
GO:0005319	0.891	lipid transporter activity
GO:0120013	0.877	lipid transfer activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010256	0.952	endomembrane system organization
GO:0006996	0.836	organelle organization
GO:0032502	0.824	developmental process
GO:0016197	0.794	endosomal transport
GO:0032501	0.788	multicellular organismal process
GO:0048856	0.749	anatomical structure development
GO:0007399	0.554	nervous system development
GO:0048869	0.450	cellular developmental process
GO:0030154	0.441	cell differentiation
GO:0051668	0.369	localization within membrane
GO:0098876	0.346	vesicle-mediated transport to the plasma membrane
GO:0048468	0.318	cell development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0098588	0.999	bounding membrane of organelle
GO:0031982	0.666	vesicle
GO:0031410	0.619	cytoplasmic vesicle
GO:0005794	0.618	Golgi apparatus
GO:0099503	0.437	secretory vesicle
GO:0031984	0.433	organelle subcompartment
GO:0012506	0.414	vesicle membrane
GO:0005793	0.359	endoplasmic reticulum-Golgi intermediate compartment
GO:0030659	0.356	cytoplasmic vesicle membrane
GO:0030141	0.337	secretory granule
GO:0000139	0.314	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]