StarFunc result for job id Q7Z7H5

User Input

>input (227 residues)
MAGVGAGPLRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDETMVIGNYRTQM
WDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRFTFTSHTPGDHQICLHSNSTR
MALFAGGKLRVHLDIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYR
EERFRLTSESTNQRVLWWSIAQTVILILTGIWQMRHLKSFFEAKKLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z7H5	1.000	1.000	1.888E-41	227	1.000	1.000	Q7Z7H5.pdb.gz	TMED4_HUMAN Transmembrane emp24 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TMED4 PE=1 SV=1
2	AFDB:Q5I0E7	0.923	0.892	4.735E-35	235	0.762	0.736	Q5I0E7.pdb.gz	TMED9_RAT Transmembrane emp24 domain-containing protein 9 OS=Rattus norvegicus OX=10116 GN=Tmed9 PE=1 SV=1
3	AFDB:Q9I7K5	0.821	0.860	1.344E-29	216	0.643	0.676	Q9I7K5.pdb.gz	TMEDE_DROME Transmembrane emp24 domain-containing protein eca OS=Drosophila melanogaster OX=7227 GN=eca PE=2 SV=2
4	AFDB:Q769F7	0.691	0.728	2.978E-22	214	0.419	0.444	Q769F7.pdb.gz	Q769F7_DICDI Emp24/gp25L/p24 family protein OS=Dictyostelium discoideum OX=44689 GN=empC PE=3 SV=1
5	AFDB:A0A024R6I3	0.737	0.761	6.781E-18	219	0.335	0.347	A0A024R6I3.pdb.gz	A0A024R6I3_HUMAN Testicular tissue protein Li 206 OS=Homo sapiens OX=9606 PE=2 SV=1
6	AFDB:P53198	0.572	0.597	1.192E-16	216	0.251	0.264	P53198.pdb.gz	ERP6_YEAST Protein ERP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERP6 PE=1 SV=1
7	AFDB:O14324	0.603	0.632	1.499E-16	215	0.282	0.298	O14324.pdb.gz	YB79_SCHPO Uncharacterized membrane protein C16E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16E9.09c PE=3 SV=1
8	AFDB:Q8SXY6	0.731	0.796	1.886E-16	206	0.256	0.282	Q8SXY6.pdb.gz	TMEDA_DROME Transmembrane emp24 domain-containing protein bai OS=Drosophila melanogaster OX=7227 GN=bai PE=2 SV=1
9	AFDB:Q05359	0.496	0.513	3.974E-16	219	0.256	0.265	Q05359.pdb.gz	ERP1_YEAST Protein ERP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERP1 PE=1 SV=1
10	AFDB:Q9FVU0	0.660	0.699	5.605E-16	212	0.273	0.292	Q9FVU0.pdb.gz	P24D4_ARATH Transmembrane emp24 domain-containing protein p24delta4 OS=Arabidopsis thaliana OX=3702 GN=CYB PE=1 SV=1
11	PDB:1olmE	0.323	0.195	4.936E-6	397	0.079	0.045	1olmE.pdb.gz	Supernatant Protein Factor in Complex with Rrr-Alpha-Tocopherylquinone: A Link between Oxidized Vitamin E and Cholesterol Biosynthesis
12	PDB:4tlgA	0.327	0.198	7.809E-6	396	0.057	0.033	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
13	PDB:4uybA	0.330	0.198	1.235E-5	401	0.075	0.042	4uybA.pdb.gz
14	PDB:5ffoG	0.197	0.160	2.435E-4	297	0.075	0.057	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
15	PDB:4dxzA	0.241	0.447	9.642E-4	111	0.040	0.081	4dxzA.pdb.gz
16	PDB:7bhqB	0.233	0.254	1.081E-3	204	0.106	0.118	7bhqB.pdb.gz
17	PDB:7drtB	0.244	0.127	1.615E-3	496	0.048	0.022	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
18	PDB:2waaA	0.185	0.134	1.711E-3	335	0.040	0.027	2waaA.pdb.gz
19	PDB:5wpwA	0.170	0.111	2.032E-3	379	0.070	0.042	5wpwA.pdb.gz
20	PDB:1fxzA	0.171	0.117	2.152E-3	371	0.079	0.049	1fxzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z7H5	3.04e-172	474	227	1.000	1.000	TMED4_HUMAN Transmembrane emp24 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=TMED4 PE=1 SV=1
2	Q9BVK6	1.99e-129	366	235	0.767	0.740	TMED9_HUMAN Transmembrane emp24 domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TMED9 PE=1 SV=2
3	Q99KF1	5.82e-127	360	235	0.767	0.740	TMED9_MOUSE Transmembrane emp24 domain-containing protein 9 OS=Mus musculus OX=10090 GN=Tmed9 PE=1 SV=2
4	Q5I0E7	1.25e-126	359	235	0.767	0.740	TMED9_RAT Transmembrane emp24 domain-containing protein 9 OS=Rattus norvegicus OX=10116 GN=Tmed9 PE=1 SV=1
5	Q9I7K5	2.22e-109	315	216	0.652	0.685	TMEDE_DROME Transmembrane emp24 domain-containing protein eca OS=Drosophila melanogaster OX=7227 GN=eca PE=2 SV=2
6	Q769F7	1.29e-58	186	214	0.423	0.449	Q769F7_DICDI Emp24/gp25L/p24 family protein OS=Dictyostelium discoideum OX=44689 GN=empC PE=3 SV=1
7	Q9D1D4	5.60e-32	118	219	0.344	0.356	TMEDA_MOUSE Transmembrane emp24 domain-containing protein 10 OS=Mus musculus OX=10090 GN=Tmed10 PE=1 SV=1
8	Q63584	6.00e-30	112	219	0.344	0.356	TMEDA_RAT Transmembrane emp24 domain-containing protein 10 OS=Rattus norvegicus OX=10116 GN=Tmed10 PE=1 SV=2
9	Q28735	7.27e-30	112	219	0.304	0.315	TMEDA_RABIT Transmembrane emp24 domain-containing protein 10 OS=Oryctolagus cuniculus OX=9986 GN=TMED10 PE=1 SV=1
10	O14324	9.07e-30	112	215	0.286	0.302	YB79_SCHPO Uncharacterized membrane protein C16E9.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16E9.09c PE=3 SV=1
11	O35587	1.80e-29	111	219	0.339	0.352	TMEDA_MESAU Transmembrane emp24 domain-containing protein 10 OS=Mesocricetus auratus OX=10036 GN=TMED10 PE=1 SV=1
12	A0A024R6I3	1.88e-29	111	219	0.300	0.311	A0A024R6I3_HUMAN Testicular tissue protein Li 206 OS=Homo sapiens OX=9606 PE=2 SV=1
13	P49755	1.88e-29	111	219	0.300	0.311	TMEDA_HUMAN Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens OX=9606 GN=TMED10 PE=1 SV=2
14	P53198	2.94e-29	110	216	0.273	0.287	ERP6_YEAST Protein ERP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERP6 PE=1 SV=1
15	Q05359	3.16e-25	100	219	0.238	0.247	ERP1_YEAST Protein ERP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERP1 PE=1 SV=1
16	Q9FVU0	1.00e-22	93.6	212	0.247	0.264	P24D4_ARATH Transmembrane emp24 domain-containing protein p24delta4 OS=Arabidopsis thaliana OX=3702 GN=CYB PE=1 SV=1
17	P38819	4.19e-22	92.0	212	0.295	0.316	ERP5_YEAST Protein ERP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ERP5 PE=1 SV=1
18	Q8SXY6	2.79e-21	89.7	206	0.264	0.291	TMEDA_DROME Transmembrane emp24 domain-containing protein bai OS=Drosophila melanogaster OX=7227 GN=bai PE=2 SV=1
19	Q8VY92	3.27e-20	87.0	214	0.238	0.252	P24DA_ARATH Transmembrane emp24 domain-containing protein p24delta10 OS=Arabidopsis thaliana OX=3702 GN=At1g69460 PE=1 SV=1
20	Q9P7I9	3.70e-19	84.0	199	0.256	0.291	EMP24_SCHPO Endosomal protein P24B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=emp24 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01105 EMP24_GP25L	3.6e-49	178.7	emp24/gp25L/p24 family/GOLD
2	PF17210 SdrD_B	2.8e+02	13.1	SdrD B-like domain
3	PF08891 YfcL	55	15.5	YfcL protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000011752

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000018339	0.962	Transmembrane emp24-like trafficking protein 10 (yeast)
2	9593.ENSGGOP00000027244	0.960	Transmembrane emp24 domain trafficking protein 2
3	9593.ENSGGOP00000009731	0.903	Transmembrane emp24 protein transport domain containing 3
4	9593.ENSGGOP00000021961	0.886	Coatomer subunit beta
5	9593.ENSGGOP00000023640	0.883	Toll like receptor adaptor molecule 2
6	9593.ENSGGOP00000024109	0.819	Transmembrane emp24 protein transport domain containing 1
7	9593.ENSGGOP00000010566	0.779	N-acetyl-alpha-glucosaminidase
8	9593.ENSGGOP00000014119	0.745	Component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, that regulates cytochrome c oxidase assembly.
9	9593.ENSGGOP00000015713	0.734	Transmembrane emp24 protein transport domain containing 5
10	9593.ENSGGOP00000017772	0.687	acyl-CoA binding domain containing 3
11	9593.ENSGGOP00000012860	0.661	STT3B, subunit of the oligosaccharyltransferase complex (catalytic)
12	9593.ENSGGOP00000007582	0.650	Uncharacterized protein
13	9593.ENSGGOP00000001889	0.640	Syntaxin 5
14	9593.ENSGGOP00000022551	0.619	Golgi reassembly stacking protein 1, 65kDa
15	9593.ENSGGOP00000002421	0.617	SEC22 vesicle trafficking protein homolog A (S. cerevisiae)
16	9593.ENSGGOP00000009628	0.602	STT3A, subunit of the oligosaccharyltransferase complex (catalytic)
17	9593.ENSGGOP00000021740	0.601	ER lumen protein-retaining receptor
18	9593.ENSGGOP00000028267	0.601	ER lumen protein-retaining receptor
19	9593.ENSGGOP00000012235	0.573	Golgi reassembly stacking protein 2, 55kDa
20	9593.ENSGGOP00000012360	0.564	Leucine rich repeat containing 46

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.927	cellular process
GO:0050789	0.925	regulation of biological process
GO:0050794	0.894	regulation of cellular process
GO:0048518	0.811	positive regulation of biological process
GO:0048522	0.798	positive regulation of cellular process
GO:0043122	0.613	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051234	0.602	establishment of localization
GO:0006810	0.579	transport
GO:0051641	0.547	cellular localization
GO:0009967	0.541	positive regulation of signal transduction
GO:0043123	0.482	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051649	0.381	establishment of localization in cell
GO:0016192	0.337	vesicle-mediated transport
GO:0071840	0.335	cellular component organization or biogenesis
GO:0048193	0.333	Golgi vesicle transport
GO:0016043	0.318	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.991	membrane
GO:0030133	0.987	transport vesicle
GO:0031090	0.972	organelle membrane
GO:0005783	0.904	endoplasmic reticulum
GO:0005794	0.821	Golgi apparatus
GO:0031984	0.813	organelle subcompartment
GO:0098588	0.803	bounding membrane of organelle
GO:0042175	0.743	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.731	endoplasmic reticulum membrane
GO:0032991	0.684	protein-containing complex
GO:0005793	0.568	endoplasmic reticulum-Golgi intermediate compartment
GO:0030659	0.426	cytoplasmic vesicle membrane
GO:0070062	0.373	extracellular exosome
GO:0070013	0.365	intracellular organelle lumen
GO:0000139	0.338	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]