StarFunc result for job id Q7Z7J7

User Input

>input (247 residues)
MLPSQEASKLYHEHYMRNSRAIGVLWAIFTICFAIINVVVFIQPYWVGDSVSTPKPGYFG
LFHYCVGSGLAGRELTCRGSFTDFSTIPSSAFKAAAFFVLLSMVLILGCITCFSLFFFCN
TATVYKICAWMQLLAALCLVLGCMIFPDGWDAETIRDMCGAKTGKYSLGDCSVRWAYILA
IIGILNALILSFLAFVLGNRQTDLLQEELKPENKDFVGSTVSSVLRPGGDVSGWGVLPCP
VAHSQGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5U4E0	0.902	0.902	6.386E-39	247	0.984	0.984	Q5U4E0.pdb.gz	LHPL4_MOUSE LHFPL tetraspan subfamily member 4 protein OS=Mus musculus OX=10090 GN=Lhfpl4 PE=1 SV=1
2	AFDB:Q86UP9	0.869	0.909	4.504E-29	236	0.680	0.712	Q86UP9.pdb.gz	LHPL3_HUMAN LHFPL tetraspan subfamily member 3 protein OS=Homo sapiens OX=9606 GN=LHFPL3 PE=1 SV=3
3	AFDB:A0A2R8QN41	0.823	0.898	7.554E-27	226	0.583	0.637	A0A2R8QN41.pdb.gz
4	AFDB:Q4KL25	0.809	0.912	3.744E-26	219	0.530	0.598	Q4KL25.pdb.gz	LHPL5_MOUSE LHFPL tetraspan subfamily member 5 protein OS=Mus musculus OX=10090 GN=Lhfpl5 PE=1 SV=1
5	AFDB:B0UYJ1	0.802	0.896	6.733E-26	221	0.522	0.584	B0UYJ1.pdb.gz	B0UYJ1_DANRE LHFPL tetraspan subfamily member 5b OS=Danio rerio OX=7955 GN=lhfpl5 PE=4 SV=1
6	AFDB:Q9W068	0.737	0.690	9.158E-18	265	0.336	0.313	Q9W068.pdb.gz	Q9W068_DROME LP10272p OS=Drosophila melanogaster OX=7227 GN=Tmhs PE=2 SV=1
7	PDB:6c14B	0.625	0.924	2.132E-13	164	0.429	0.646	6c14B.pdb.gz
8	AFDB:Q6ZUX7	0.635	0.684	5.392E-12	228	0.194	0.211	Q6ZUX7.pdb.gz	LHPL2_HUMAN LHFPL tetraspan subfamily member 2 protein OS=Homo sapiens OX=9606 GN=LHFPL2 PE=1 SV=2
9	AFDB:Q86WI0	0.630	0.702	5.999E-12	220	0.202	0.227	Q86WI0.pdb.gz	LHPL1_HUMAN LHFPL tetraspan subfamily member 1 protein OS=Homo sapiens OX=9606 GN=LHFPL1 PE=1 SV=1
10	AFDB:Q8BGA2	0.607	0.671	1.181E-9	222	0.206	0.230	Q8BGA2.pdb.gz	LHPL2_MOUSE LHFPL tetraspan subfamily member 2 protein OS=Mus musculus OX=10090 GN=Lhfpl2 PE=1 SV=1
11	AFDB:A1Z6H0	0.649	0.611	2.925E-9	264	0.162	0.152	A1Z6H0.pdb.gz	A1Z6H0_DROME Kune-kune OS=Drosophila melanogaster OX=7227 GN=kune PE=1 SV=1
12	PDB:7ocaI	0.582	0.758	2.794E-7	185	0.113	0.151	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
13	PDB:7rz4A	0.577	0.161	5.591E-7	993	0.130	0.032	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
14	PDB:5kbtA	0.504	0.149	2.239E-6	973	0.134	0.034	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
15	PDB:7rzaA	0.548	0.156	4.725E-6	981	0.117	0.030	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
16	PDB:5b2gC	0.513	0.373	1.449E-5	350	0.101	0.071	5b2gC.pdb.gz
17	PDB:6jp5E	0.528	0.749	2.470E-5	169	0.089	0.130	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
18	PDB:5weoA	0.560	0.150	4.212E-5	988	0.121	0.030	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
19	PDB:6ov2A	0.501	0.659	1.224E-4	182	0.101	0.137	6ov2A.pdb.gz
20	PDB:6wxuB	0.453	0.416	1.861E-3	273	0.105	0.095	6wxuB.pdb.gz	Structures of mouse DUOX1-DUOXA1 provide mechanistic insights into enzyme activation and regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5U4E0	0.0	501	247	0.984	0.984	LHPL4_MOUSE LHFPL tetraspan subfamily member 4 protein OS=Mus musculus OX=10090 GN=Lhfpl4 PE=1 SV=1
2	Q7TSY2	0.0	501	247	0.984	0.984	LHPL4_RAT LHFPL tetraspan subfamily member 4 protein OS=Rattus norvegicus OX=10116 GN=Lhfpl4 PE=1 SV=1
3	Q7Z7J7	0.0	507	247	1.000	1.000	LHPL4_HUMAN LHFPL tetraspan subfamily member 4 protein OS=Homo sapiens OX=9606 GN=LHFPL4 PE=1 SV=1
4	Q86UP9	2.68e-126	359	236	0.680	0.712	LHPL3_HUMAN LHFPL tetraspan subfamily member 3 protein OS=Homo sapiens OX=9606 GN=LHFPL3 PE=1 SV=3
5	F1Q837	8.44e-111	319	219	0.583	0.658	F1Q837_DANRE LHFPL tetraspan subfamily member 5a OS=Danio rerio OX=7955 GN=lhfpl5a PE=4 SV=2
6	Q4KL25	1.68e-100	293	219	0.547	0.616	LHPL5_MOUSE LHFPL tetraspan subfamily member 5 protein OS=Mus musculus OX=10090 GN=Lhfpl5 PE=1 SV=1
7	Q5PPI7	1.68e-100	293	219	0.547	0.616	LHPL5_RAT LHFPL tetraspan subfamily member 5 protein OS=Rattus norvegicus OX=10116 GN=Lhfpl5 PE=2 SV=1
8	Q8TAF8	8.05e-100	291	219	0.543	0.612	LHPL5_HUMAN LHFPL tetraspan subfamily member 5 protein OS=Homo sapiens OX=9606 GN=LHFPL5 PE=1 SV=1
9	B0UYJ1	8.13e-94	276	221	0.534	0.597	B0UYJ1_DANRE LHFPL tetraspan subfamily member 5b OS=Danio rerio OX=7955 GN=lhfpl5 PE=4 SV=1
10	A8KB64	9.02e-94	276	216	0.534	0.611	A8KB64_DANRE LHFPL tetraspan subfamily member 5b OS=Danio rerio OX=7955 GN=lhfpl5b PE=2 SV=1
11	Q9W068	3.31e-49	164	265	0.332	0.309	Q9W068_DROME LP10272p OS=Drosophila melanogaster OX=7227 GN=Tmhs PE=2 SV=1
12	Q6ZUX7	9.35e-12	64.7	228	0.239	0.259	LHPL2_HUMAN LHFPL tetraspan subfamily member 2 protein OS=Homo sapiens OX=9606 GN=LHFPL2 PE=1 SV=2
13	Q8BGA2	1.48e-09	58.5	222	0.243	0.270	LHPL2_MOUSE LHFPL tetraspan subfamily member 2 protein OS=Mus musculus OX=10090 GN=Lhfpl2 PE=1 SV=1
14	Q86WI0	9.28e-09	56.2	220	0.215	0.241	LHPL1_HUMAN LHFPL tetraspan subfamily member 1 protein OS=Homo sapiens OX=9606 GN=LHFPL1 PE=1 SV=1
15	Q7GB25	2.2	32.0	1514	0.146	0.024	AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana OX=3702 GN=ABCC5 PE=2 SV=2
16	Q2M2N3	2.9	31.2	262	0.089	0.084	Q2M2N3_MOUSE Klra18 protein OS=Mus musculus OX=10090 GN=Klra18 PE=2 SV=1
17	Q9JHV4	3.0	31.2	263	0.089	0.084	Q9JHV4_MOUSE Klra18 protein OS=Mus musculus OX=10090 GN=Klra18 PE=2 SV=1
18	Q4Z8P6	3.2	31.2	263	0.089	0.084	Q4Z8P6_MOUSE Killer cell lectin-like receptor subfamily A member 18 OS=Mus musculus OX=10090 GN=Klra18 PE=2 SV=1
19	Q9JIQ1	4.1	30.8	268	0.109	0.101	Q9JIQ1_MOUSE Lectin-related NK cell receptor LY49L2 OS=Mus musculus OX=10090 GN=Klra12 PE=2 SV=1
20	O88662	4.2	30.4	172	0.194	0.279	EMP2_MOUSE Epithelial membrane protein 2 OS=Mus musculus OX=10090 GN=Emp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	1.7	19.9	PMP-22/EMP/MP20/Claudin tight junction
2	PF10242 L_HMGIC_fpl	8e-65	230.0	Lipoma HMGIC fusion partner-like protein
3	PF00822 PMP22_Claudin	2.3	19.5	PMP-22/EMP/MP20/Claudin family
4	PF18142 SLATT_fungal	4.8e+02	12.1	SMODS and SLOG-associating 2TM effector domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287585

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305288	0.812	Neuroligin-2
2	9606.ENSP00000417901	0.723	Gephyrin
3	9606.ENSP00000261592	0.667	Nucleolar protein 4
4	9606.ENSP00000363068	0.631	Protocadherin-15
5	9606.ENSP00000436552	0.621	Protein turtle homolog B
6	9606.ENSP00000383295	0.602	Neurobeachin
7	9606.ENSP00000378338	0.601	ARF GTPase-activating protein GIT1
8	9606.ENSP00000366645	0.559	SCP2 sterol-binding domain-containing protein 1
9	9606.ENSP00000359892	0.557	Choline transporter-like protein 5
10	9606.ENSP00000274545	0.553	Gamma-aminobutyric acid receptor subunit alpha-6
11	9606.ENSP00000373340	0.542	Peregrin
12	9606.ENSP00000305926	0.529	OTU domain-containing protein 7A
13	9606.ENSP00000392511	0.524	Proline rich transmembrane protein 3
14	9606.ENSP00000253401	0.519	Rho guanine nucleotide exchange factor 9
15	9606.ENSP00000289416	0.510	Acyl-coenzyme A synthetase ACSM3, mitochondrial
16	9606.ENSP00000429608	0.507	FANCD2 opposite strand
17	9606.ENSP00000457205	0.501	UPF0583 protein C15orf59
18	9606.ENSP00000284881	0.500	Protein EURL homolog
19	9606.ENSP00000309772	0.500	Cadherin like and PC-esterase domain containing 1
20	9606.ENSP00000369981	0.500	Endophilin-A1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050811	0.863	GABA receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071840	0.955	cellular component organization or biogenesis
GO:0050794	0.927	regulation of cellular process
GO:0016043	0.890	cellular component organization
GO:0051179	0.846	localization
GO:0008104	0.784	protein localization
GO:0065008	0.585	regulation of biological quality
GO:0033365	0.560	protein localization to organelle
GO:0051668	0.551	localization within membrane
GO:0050808	0.528	synapse organization
GO:0072657	0.510	protein localization to membrane
GO:1901888	0.486	regulation of cell junction assembly
GO:1902414	0.481	protein localization to cell junction
GO:0097120	0.461	receptor localization to synapse
GO:0035418	0.453	protein localization to synapse
GO:1990778	0.447	protein localization to cell periphery
GO:0050803	0.434	regulation of synapse structure or activity
GO:0062237	0.430	protein localization to postsynapse
GO:0032501	0.423	multicellular organismal process
GO:0050807	0.373	regulation of synapse organization
GO:0099072	0.365	regulation of postsynaptic membrane neurotransmitter receptor levels
GO:0061024	0.317	membrane organization
GO:0001941	0.309	postsynaptic membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045202	0.997	synapse
GO:0005886	0.991	plasma membrane
GO:0060077	0.983	inhibitory synapse
GO:0043226	0.970	organelle
GO:0005622	0.746	intracellular anatomical structure
GO:0043227	0.738	membrane-bounded organelle
GO:0043229	0.738	intracellular organelle
GO:0098590	0.699	plasma membrane region
GO:0005737	0.528	cytoplasm
GO:0098794	0.486	postsynapse
GO:0097060	0.482	synaptic membrane
GO:0045211	0.428	postsynaptic membrane
GO:0098982	0.408	GABA-ergic synapse
GO:0043231	0.352	intracellular membrane-bounded organelle
GO:0099572	0.344	postsynaptic specialization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]