StarFunc result for job id Q7Z7K6

User Input

>input (275 residues)
MRRSRSSAAAKLRGQKRSGASGASAAPAASAAAALAPSATRTRRSASQAGSKSQAVEKPP
SEKPRLRRSSPRAQEEGPGEPPPPELALLPPPPPPPPTPATPTSSASNLDLGEQRERWET
FQKRQKLTSEGAAKLLLDTFEYQGLVKHTGGCHCGAVRFEVWASADLHIFDCNCSICKKK
QNRHFIVPASRFKLLKGAEHITTYTFNTHKAQHTFCKRCGVQSFYTPRSNPGGFGIAPHC
LDEGTVRSMVTEEFNGSDWEKAMKEHKTIKNMSKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z7K6	1.000	1.000	1.264E-50	275	1.000	1.000	Q7Z7K6.pdb.gz	CENPV_HUMAN Centromere protein V OS=Homo sapiens OX=9606 GN=CENPV PE=1 SV=1
2	PDB:2kv1A	0.147	0.287	2.130E-1	124	0.033	0.073	2kv1A.pdb.gz
3	AFDB:Q388Q4	0.129	0.082	3.413E-1	522	0.160	0.084	Q388Q4.pdb.gz	Q388Q4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.05.0160 PE=4 SV=1
4	AFDB:Q583P6	0.113	0.041	4.674E-1	1085	0.109	0.028	Q583P6.pdb.gz	Q583P6_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.490 PE=3 SV=1
5	PDB:8dysA	0.140	0.101	5.138E-1	409	0.062	0.042	8dysA.pdb.gz
6	AFDB:Q9I8J4	0.127	0.085	5.301E-1	443	0.095	0.059	Q9I8J4.pdb.gz	Q9I8J4_CHICK Smoothelin-C OS=Gallus gallus OX=9031 GN=Smtn PE=2 SV=1
7	PDB:7wtlSX	0.093	0.138	7.036E-1	121	0.040	0.091	7wtlSX.pdb.gz	In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.
8	PDB:6dxwA	0.105	0.090	7.493E-1	328	0.040	0.034	6dxwA.pdb.gz
9	PDB:4qd2C	0.115	0.111	9.048E-1	286	0.018	0.017	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
10	PDB:7b9vp	0.097	0.273	1.093	77	0.040	0.143	7b9vp.pdb.gz	Structural basis for conformational equilibrium of the catalytic spliceosome.
11	PDB:1zxuA	0.113	0.174	1.164	162	0.033	0.056	1zxuA.pdb.gz
12	AFDB:A0A3S5ZPL0	0.115	0.078	1.450	452	0.138	0.084	A0A3S5ZPL0.pdb.gz	A0A3S5ZPL0_BOVIN G protein subunit beta 5 OS=Bos taurus OX=9913 GN=GNB5 PE=3 SV=1
13	PDB:7q3dA	0.082	0.048	1.594	545	0.029	0.015	7q3dA.pdb.gz
14	PDB:1pugA	0.074	0.192	1.697	94	0.018	0.053	1pugA.pdb.gz
15	PDB:6ppqG	0.135	0.338	1.697	85	0.040	0.129	6ppqG.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
16	AFDB:O22609	0.129	0.095	1.864	439	0.120	0.075	O22609.pdb.gz	DEGP1_ARATH Protease Do-like 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=DEGP1 PE=1 SV=2
17	AFDB:Q9P7S5	0.109	0.049	1.864	875	0.109	0.034	Q9P7S5.pdb.gz	UBP7_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp7 PE=1 SV=1
18	AFDB:O45030	0.130	0.069	2.114	584	0.087	0.041	O45030.pdb.gz	O45030_DROME Vang-like protein OS=Drosophila melanogaster OX=7227 GN=Vang PE=2 SV=1
19	AFDB:B9EJ86	0.123	0.053	2.251	889	0.145	0.045	B9EJ86.pdb.gz	OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus OX=10090 GN=Osbpl8 PE=1 SV=1
20	AFDB:Q9R0H5	0.120	0.073	3.283	524	0.109	0.057	Q9R0H5.pdb.gz	K2C71_MOUSE Keratin, type II cytoskeletal 71 OS=Mus musculus OX=10090 GN=Krt71 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z7K6	0.0	565	275	1.000	1.000	CENPV_HUMAN Centromere protein V OS=Homo sapiens OX=9606 GN=CENPV PE=1 SV=1
2	B7Z0W9	1.1	33.5	1576	0.124	0.022	OTOP_DROME Proton channel OtopLc OS=Drosophila melanogaster OX=7227 GN=OtopLc PE=3 SV=2
3	Q63638	6.5	30.8	3259	0.091	0.008	SPEG_RAT Striated muscle-specific serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Speg PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04828 GFA	3.5e-05	35.4	Glutathione-dependent formaldehyde-activating enzyme
2	PF01907 Ribosomal_L37e	34	16.0	Ribosomal protein L37e

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299736

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293362	0.852	Proteasome activator complex subunit 3
2	9606.ENSP00000222247	0.828	Belongs to the eukaryotic ribosomal protein eL20 family.
3	9606.ENSP00000263253	0.814	Histone acetyltransferase p300
4	9606.ENSP00000266970	0.772	Cyclin-dependent kinase 2
5	9606.ENSP00000252951	0.755	Hemoglobin subunit zeta
6	9606.ENSP00000227163	0.748	Transcription factor PU.1
7	9606.ENSP00000302289	0.738	Embigin
8	9606.ENSP00000365439	0.725	Heterogeneous nuclear ribonucleoprotein K
9	9606.ENSP00000389182	0.710	Ribonuclease P protein subunit p30
10	9606.ENSP00000344140	0.699	Protein phosphatase 1 regulatory subunit 32
11	9606.ENSP00000351446	0.684	WD repeat-containing protein 5
12	9606.ENSP00000356780	0.680	Coiled-coil domain-containing protein 181
13	9606.ENSP00000381270	0.660	Protein broad-minded
14	9606.ENSP00000308413	0.654	Ribosomal protein S6 kinase beta-2
15	9606.ENSP00000206513	0.649	CCAAT/enhancer-binding protein epsilon
16	9606.ENSP00000370588	0.634	CD99 antigen
17	9606.ENSP00000375849	0.631	Otospiralin
18	9606.ENSP00000369344	0.611	Probable G-protein coupled receptor 150
19	9606.ENSP00000335808	0.603	Protein FAM192A
20	9606.ENSP00000427514	0.601	CCAAT/enhancer-binding protein alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.773	organic cyclic compound binding
GO:1901363	0.693	heterocyclic compound binding
GO:0003676	0.652	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0019222	0.972	regulation of metabolic process
GO:0051128	0.957	regulation of cellular component organization
GO:0048518	0.940	positive regulation of biological process
GO:0060255	0.932	regulation of macromolecule metabolic process
GO:0048519	0.927	negative regulation of biological process
GO:0048522	0.927	positive regulation of cellular process
GO:0010468	0.922	regulation of gene expression
GO:0016043	0.920	cellular component organization
GO:0010605	0.890	negative regulation of macromolecule metabolic process
GO:0040029	0.881	epigenetic regulation of gene expression
GO:0022607	0.870	cellular component assembly
GO:0006996	0.858	organelle organization
GO:0006338	0.853	chromatin remodeling
GO:0071824	0.835	protein-DNA complex subunit organization
GO:0065004	0.833	protein-DNA complex assembly
GO:0051276	0.830	chromosome organization
GO:0031507	0.806	heterochromatin formation
GO:0034508	0.803	centromere complex assembly
GO:0031048	0.799	RNA-mediated heterochromatin formation
GO:0051302	0.738	regulation of cell division
GO:0033043	0.695	regulation of organelle organization
GO:0140719	0.606	constitutive heterochromatin formation
GO:0051726	0.529	regulation of cell cycle
GO:0051781	0.488	positive regulation of cell division
GO:0071704	0.465	organic substance metabolic process
GO:0044238	0.401	primary metabolic process
GO:0006807	0.384	nitrogen compound metabolic process
GO:0080090	0.381	regulation of primary metabolic process
GO:0051171	0.381	regulation of nitrogen compound metabolic process
GO:0010564	0.378	regulation of cell cycle process
GO:0033044	0.334	regulation of chromosome organization
GO:0043170	0.330	macromolecule metabolic process
GO:1901564	0.317	organonitrogen compound metabolic process
GO:0031323	0.312	regulation of cellular metabolic process
GO:0048523	0.305	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005654	1.000	nucleoplasm
GO:0012505	0.999	endomembrane system
GO:0005829	0.999	cytosol
GO:0000776	0.997	kinetochore
GO:0031967	0.995	organelle envelope
GO:0031090	0.994	organelle membrane
GO:0005635	0.994	nuclear envelope
GO:0005819	0.988	spindle
GO:0030496	0.985	midbody
GO:0031965	0.983	nuclear membrane
GO:0051233	0.980	spindle midzone
GO:0032991	0.453	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]