StarFunc result for job id Q7Z7M8

User Input

>input (397 residues)
MRCPKCLLCLSALLTLLGLKVYIEWTSESRLSKAYPSPRGTPPSPTPANPEPTLPANLST
RLGQTIPLPFAYWNQQQWRLGSLPSGDSTETGGCQAWGAAAATEIPDFASYPKDLRRFLL
SAACRSFPQWLPGGGGSQVSSCSDTDVPYLLLAVKSEPGRFAERQAVRETWGSPAPGIRL
LFLLGSPVGEAGPDLDSLVAWESRRYSDLLLWDFLDVPFNQTLKDLLLLAWLGRHCPTVS
FVLRAQDDAFVHTPALLAHLRALPPASARSLYLGEVFTQAMPLRKPGGPFYVPESFFEGG
YPAYASGGGYVIAGRLAPWLLRAAARVAPFPFEDVYTGLCIRALGLVPQAHPGFLTAWPA
DRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z7M8	1.000	1.000	3.990E-86	397	1.000	1.000	Q7Z7M8.pdb.gz	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
2	AFDB:Q9Z222	0.741	0.741	5.754E-38	397	0.327	0.327	Q9Z222.pdb.gz	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
3	AFDB:Q9NY97	0.734	0.734	4.220E-35	397	0.310	0.310	Q9NY97.pdb.gz	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
4	PDB:7jhiC	0.736	0.877	1.923E-34	331	0.292	0.350	7jhiC.pdb.gz	Structures and mechanism of human glycosyltransferase beta 1,3-N-acetylglucosaminyltransferase 2 (B3GNT2), an important player in immune homeostasis.
5	AFDB:Q6ZMB0	0.691	0.713	1.044E-33	384	0.327	0.339	Q6ZMB0.pdb.gz	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
6	AFDB:Q9Y2A9	0.675	0.718	1.245E-31	372	0.307	0.328	Q9Y2A9.pdb.gz	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
7	AFDB:Q8NFL0	0.692	0.685	1.582E-30	401	0.317	0.314	Q8NFL0.pdb.gz	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
8	AFDB:Q8K0J2	0.692	0.692	3.080E-30	397	0.317	0.317	Q8K0J2.pdb.gz	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
9	AFDB:Q9C0J1	0.672	0.704	9.727E-30	378	0.330	0.347	Q9C0J1.pdb.gz	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
10	AFDB:O54904	0.601	0.726	3.648E-25	326	0.229	0.279	O54904.pdb.gz	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
11	AFDB:O43825	0.600	0.565	8.512E-25	422	0.232	0.218	O43825.pdb.gz	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
12	PDB:4y63A	0.296	0.387	1.689E-6	282	0.078	0.110	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
13	PDB:6fxrA	0.337	0.208	1.795E-6	700	0.108	0.061	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
14	PDB:1ll0B	0.314	0.433	5.010E-5	267	0.106	0.157	1ll0B.pdb.gz
15	PDB:7d72A	0.297	0.291	1.036E-4	407	0.086	0.084	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
16	PDB:8cvzI	0.289	0.397	1.402E-4	267	0.081	0.120	8cvzI.pdb.gz
17	PDB:2gamC	0.379	0.399	1.681E-4	374	0.103	0.110	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
18	PDB:3r2wC	0.228	0.206	4.428E-4	450	0.073	0.064	3r2wC.pdb.gz
19	PDB:4fixA	0.309	0.207	4.704E-4	629	0.083	0.052	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
20	PDB:4hg6A	0.329	0.188	5.641E-4	747	0.126	0.067	4hg6A.pdb.gz	Crystallographic snapshot of cellulose synthesis and membrane translocation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z7M8	0.0	791	397	1.000	1.000	B3GN8_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8 OS=Homo sapiens OX=9606 GN=B3GNT8 PE=1 SV=1
2	Q9Z222	1.30e-73	236	397	0.317	0.317	B3GN2_MOUSE N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Mus musculus OX=10090 GN=B3GNT2 PE=1 SV=3
3	Q9NY97	7.92e-71	229	397	0.300	0.300	B3GN2_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GNT2 PE=1 SV=2
4	Q6ZMB0	3.12e-50	175	384	0.292	0.302	B3GN6_HUMAN Acetylgalactosaminyl-O-glycosyl-glycoprotein beta-1,3-N-acetylglucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT6 PE=1 SV=2
5	Q9Y2A9	3.12e-50	175	372	0.270	0.288	B3GN3_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 3 OS=Homo sapiens OX=9606 GN=B3GNT3 PE=1 SV=2
6	Q8K0J2	4.40e-50	175	397	0.305	0.305	B3GN7_MOUSE UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Mus musculus OX=10090 GN=B3gnt7 PE=2 SV=2
7	Q9C0J1	1.14e-49	174	378	0.292	0.307	B3GN4_HUMAN N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GNT4 PE=1 SV=1
8	Q8NFL0	3.43e-49	173	401	0.277	0.274	B3GN7_HUMAN UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7 OS=Homo sapiens OX=9606 GN=B3GNT7 PE=1 SV=1
9	Q9BYG0	2.55e-41	151	378	0.217	0.228	B3GN5_HUMAN Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Homo sapiens OX=9606 GN=B3GNT5 PE=1 SV=1
10	O54904	2.33e-38	142	326	0.194	0.236	B3GT1_MOUSE Beta-1,3-galactosyltransferase 1 OS=Mus musculus OX=10090 GN=B3galt1 PE=1 SV=2
11	Q9Y5Z6	2.33e-38	142	326	0.194	0.236	B3GT1_HUMAN Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1
12	Q99NB2	1.77e-37	141	377	0.186	0.196	B3GN5_RAT Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Rattus norvegicus OX=10116 GN=B3gnt5 PE=2 SV=2
13	O43825	1.87e-35	137	422	0.199	0.187	B3GT2_HUMAN Beta-1,3-galactosyltransferase 2 OS=Homo sapiens OX=9606 GN=B3GALT2 PE=1 SV=1
14	O54905	3.10e-35	136	422	0.196	0.185	B3GT2_MOUSE Beta-1,3-galactosyltransferase 2 OS=Mus musculus OX=10090 GN=B3galt2 PE=1 SV=2
15	Q8BGY6	6.90e-35	134	376	0.181	0.191	B3GN5_MOUSE Lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase OS=Mus musculus OX=10090 GN=B3gnt5 PE=2 SV=1
16	Q9Y2C3	2.66e-33	128	310	0.196	0.252	B3GT5_HUMAN Beta-1,3-galactosyltransferase 5 OS=Homo sapiens OX=9606 GN=B3GALT5 PE=1 SV=1
17	Q9JI67	4.93e-29	117	308	0.179	0.231	B3GT5_MOUSE Beta-1,3-galactosyltransferase 5 OS=Mus musculus OX=10090 GN=B3galt5 PE=2 SV=1
18	O96024	6.48e-27	112	378	0.234	0.246	B3GT4_HUMAN Beta-1,3-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B3GALT4 PE=1 SV=1
19	Q920V1	4.24e-25	106	331	0.189	0.227	B3GL1_MOUSE UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Mus musculus OX=10090 GN=B3galnt1 PE=2 SV=2
20	O75752	8.42e-25	105	331	0.191	0.230	B3GL1_HUMAN UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALNT1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01762 Galactosyl_T	3.9e-24	97.1	Galactosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312700

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302716	0.903	Mucin-17
2	9606.ENSP00000414350	0.901	Mucin-20
3	9606.ENSP00000311364	0.900	Mucin-like protein 1
4	9606.ENSP00000365473	0.900	Mucin-21
5	9606.ENSP00000368771	0.900	Mucin-3A
6	9606.ENSP00000381008	0.900	Mucin-16
7	9606.ENSP00000406861	0.900	Mucin-6
8	9606.ENSP00000407422	0.900	Mucin-7
9	9606.ENSP00000416753	0.900	Mucin-15
10	9606.ENSP00000417498	0.900	Mucin-4
11	9606.ENSP00000436812	0.900	Mucin-5B
12	9606.ENSP00000441929	0.900	Mucin-12
13	9606.ENSP00000484824	0.900	Mucin-1
14	9606.ENSP00000485028	0.900	Mucin-13
15	9606.ENSP00000485659	0.900	Mucin-5AC
16	9606.ENSP00000359333	0.533	Protein FAM69A
17	9606.ENSP00000334849	0.532	Transmembrane protein 104
18	9606.ENSP00000431254	0.511	Immunoglobulin lambda like polypeptide 5
19	9606.ENSP00000336729	0.508	Polypeptide N-acetylgalactosaminyltransferase 16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0048531	1.000	beta-1,3-galactosyltransferase activity
GO:0035250	1.000	UDP-galactosyltransferase activity
GO:0016262	0.996	protein N-acetylglucosaminyltransferase activity
GO:0008499	0.985	UDP-galactose:beta-N-acetylglucosamine beta-1,3-galactosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:1901135	0.996	carbohydrate derivative metabolic process
GO:0044237	0.995	cellular metabolic process
GO:1901566	0.995	organonitrogen compound biosynthetic process
GO:1901137	0.992	carbohydrate derivative biosynthetic process
GO:0019538	0.985	protein metabolic process
GO:0034645	0.985	cellular macromolecule biosynthetic process
GO:0009101	0.978	glycoprotein biosynthetic process
GO:0070085	0.973	glycosylation
GO:0006486	0.960	protein glycosylation
GO:0006493	0.829	protein O-linked glycosylation
GO:0006023	0.820	aminoglycan biosynthetic process
GO:0016051	0.719	carbohydrate biosynthetic process
GO:0034637	0.703	cellular carbohydrate biosynthetic process
GO:0033692	0.668	cellular polysaccharide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0005576	0.986	extracellular region
GO:0031982	0.966	vesicle
GO:0065010	0.966	extracellular membrane-bounded organelle
GO:0070062	0.921	extracellular exosome
GO:0070013	0.535	intracellular organelle lumen
GO:0071944	0.499	cell periphery
GO:0005886	0.491	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16533	0.996	L-asparaginyl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = H(+) + N(4)-(N-acetyl-beta-D-glucosaminyl)-L-asparaginyl-[protein] + UDP
EC:2.4.1.94	0.996	protein N-acetylglucosaminyltransferase.

[back to server]