StarFunc result for job id Q86SE5

User Input

>input (291 residues)
MTGKTQTSNVTNKNDPKSINSRVFIGNLNTAIVKKVDIEAIFSKYGKIVGCSVHKGYAFV
QYMSERHARAAVAGENARVIAGQPLDINMAGEPKPYRPKPGNKRPLSALYRLESKEPFLS
VGGYVFDYDYYRDDFYNRLFDYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSR
STASGSTGSKLKSDELQTIKKELTQIKTKIDSLLGRLEKIEKQQKAEAEAQKKQLEESLV
LIQEECVSEIADHSTEEPAEGGPDADGEEMTDGIEEDFDEDGGHELFLQIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86SE5	1.000	1.000	3.259E-49	291	1.000	1.000	Q86SE5.pdb.gz	RALYL_HUMAN RNA-binding Raly-like protein OS=Homo sapiens OX=9606 GN=RALYL PE=1 SV=2
2	AFDB:Q64012	0.346	0.324	1.356E-26	312	0.533	0.497	Q64012.pdb.gz	RALY_MOUSE RNA-binding protein Raly OS=Mus musculus OX=10090 GN=Raly PE=1 SV=3
3	AFDB:Q53GL6	0.346	0.329	8.133E-26	307	0.536	0.508	Q53GL6.pdb.gz	Q53GL6_HUMAN RNA binding protein (Autoantigenic, hnRNP-associated with lethal yellow) long isoform variant (Fragment) OS=Homo sapiens OX=9606 GN=RALY PE=1 SV=1
4	AFDB:Q9Z204	0.344	0.326	5.213E-25	313	0.481	0.447	Q9Z204.pdb.gz	HNRPC_MOUSE Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Mus musculus OX=10090 GN=Hnrnpc PE=1 SV=1
5	AFDB:B2RXH8	0.314	0.311	5.680E-24	293	0.464	0.461	B2RXH8.pdb.gz	HNRC2_HUMAN Heterogeneous nuclear ribonucleoprotein C-like 2 OS=Homo sapiens OX=9606 GN=HNRNPCL2 PE=1 SV=1
6	AFDB:Q803J4	0.351	0.330	5.073E-23	313	0.440	0.409	Q803J4.pdb.gz	Q803J4_DANRE Heterogeneous nuclear ribonucleoprotein C OS=Danio rerio OX=7955 GN=zgc:55701 PE=1 SV=1
7	AFDB:B5X1C7	0.279	0.121	2.160E-9	676	0.189	0.081	B5X1C7.pdb.gz	B5X1C7_SALSA Nuclear receptor coactivator 5 OS=Salmo salar OX=8030 GN=NCOA5 PE=2 SV=1
8	AFDB:Q387K1	0.251	0.333	5.468E-9	219	0.110	0.146	Q387K1.pdb.gz	Q387K1_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0620 PE=4 SV=1
9	AFDB:F1RAH8	0.251	0.167	7.618E-9	450	0.186	0.120	F1RAH8.pdb.gz	F1RAH8_DANRE RNA-binding motif protein X-linked 2 OS=Danio rerio OX=7955 GN=im:7141316 PE=4 SV=1
10	AFDB:P17133	0.267	0.179	1.929E-8	448	0.203	0.132	P17133.pdb.gz	RU17_DROME U1 small nuclear ribonucleoprotein 70 kDa OS=Drosophila melanogaster OX=7227 GN=snRNP-U1-70K PE=1 SV=2
11	PDB:3lqvB	0.234	0.580	1.449E-6	115	0.096	0.243	3lqvB.pdb.gz	Branch Recognition by SF3b14
12	PDB:6qx91K	0.262	0.372	4.477E-6	201	0.069	0.100	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
13	PDB:7oqcF	0.231	0.251	7.124E-6	267	0.110	0.120	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
14	PDB:5gm6V	0.231	0.516	9.289E-6	128	0.100	0.227	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:7dvqY	0.233	0.476	1.134E-5	140	0.086	0.179	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
16	PDB:5xjcw	0.233	0.706	1.211E-5	91	0.069	0.220	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
17	PDB:1hl6A	0.239	0.569	1.927E-5	119	0.065	0.160	1hl6A.pdb.gz
18	PDB:5yzg1	0.233	0.278	1.927E-5	243	0.065	0.078	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:3pgwP	0.243	0.605	3.277E-5	113	0.082	0.212	3pgwP.pdb.gz
20	PDB:6ff7X	0.234	0.387	4.273E-5	171	0.082	0.140	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3KT61	0.0	567	280	0.959	0.996	B3KT61_HUMAN RALY RNA binding protein like OS=Homo sapiens OX=9606 GN=RALYL PE=1 SV=1
2	Q86SE5	0.0	599	291	1.000	1.000	RALYL_HUMAN RNA-binding Raly-like protein OS=Homo sapiens OX=9606 GN=RALYL PE=1 SV=2
3	Q64012	2.01e-93	280	312	0.522	0.487	RALY_MOUSE RNA-binding protein Raly OS=Mus musculus OX=10090 GN=Raly PE=1 SV=3
4	E5RJ39	9.69e-82	244	146	0.433	0.863	E5RJ39_HUMAN RALY RNA binding protein like OS=Homo sapiens OX=9606 GN=RALYL PE=1 SV=1
5	G3V9R8	1.81e-79	244	298	0.454	0.443	HNRPC_RAT Heterogeneous nuclear ribonucleoprotein C OS=Rattus norvegicus OX=10116 GN=Hnrnpc PE=1 SV=2
6	G3V2Q1	7.51e-79	243	305	0.457	0.436	G3V2Q1_HUMAN Heterogeneous nuclear ribonucleoprotein C OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=1
7	Q9Z204	1.60e-78	243	313	0.457	0.425	HNRPC_MOUSE Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Mus musculus OX=10090 GN=Hnrnpc PE=1 SV=1
8	P07910	3.43e-78	241	306	0.454	0.431	HNRPC_HUMAN Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=4
9	G3V576	6.68e-78	238	231	0.454	0.571	G3V576_HUMAN Heterogeneous nuclear ribonucleoprotein C OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=1
10	Q9UKM9	8.25e-77	238	306	0.515	0.490	RALY_HUMAN RNA-binding protein Raly OS=Homo sapiens OX=9606 GN=RALY PE=1 SV=1
11	Q53GL6	8.51e-77	238	307	0.515	0.489	Q53GL6_HUMAN RNA binding protein (Autoantigenic, hnRNP-associated with lethal yellow) long isoform variant (Fragment) OS=Homo sapiens OX=9606 GN=RALY PE=1 SV=1
12	O60812	3.97e-75	233	293	0.502	0.498	HNRC1_HUMAN Heterogeneous nuclear ribonucleoprotein C-like 1 OS=Homo sapiens OX=9606 GN=HNRNPCL1 PE=1 SV=1
13	Q803J4	2.57e-73	229	313	0.430	0.399	Q803J4_DANRE Heterogeneous nuclear ribonucleoprotein C OS=Danio rerio OX=7955 GN=zgc:55701 PE=1 SV=1
14	B2RXH8	1.12e-72	227	293	0.430	0.427	HNRC2_HUMAN Heterogeneous nuclear ribonucleoprotein C-like 2 OS=Homo sapiens OX=9606 GN=HNRNPCL2 PE=1 SV=1
15	G3V575	1.03e-58	187	187	0.354	0.551	G3V575_HUMAN Heterogeneous nuclear ribonucleoprotein C (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=1
16	G3V555	2.27e-56	181	175	0.344	0.571	G3V555_HUMAN Heterogeneous nuclear ribonucleoprotein C (Fragment) OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=1
17	B5X1C7	9.15e-16	79.7	676	0.124	0.053	B5X1C7_SALSA Nuclear receptor coactivator 5 OS=Salmo salar OX=8030 GN=NCOA5 PE=2 SV=1
18	A0A0S2Z4Z0	6.16e-09	58.9	669	0.189	0.082	A0A0S2Z4Z0_HUMAN RNA binding motif protein 14 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM14 PE=2 SV=1
19	Q96PK6	6.16e-09	58.9	669	0.189	0.082	RBM14_HUMAN RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2
20	Q8C2Q3	9.79e-09	58.5	669	0.186	0.081	RBM14_MOUSE RNA-binding protein 14 OS=Mus musculus OX=10090 GN=Rbm14 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17675 APG6_N	4.8e+02	12.6	Apg6 coiled-coil region
2	PF11307 DUF3109	90	14.4	Protein of unknown function (DUF3109)
3	PF20570 DUF6779	7.6e+02	12.2	Domain of unknown function (DUF6779)
4	PF14282 FlxA	1.6e+02	13.8	FlxA-like protein
5	PF17335 IES5	94	14.7	Ino80 complex subunit 5
6	PF14942 Muted	5.1e+02	12.3	Organelle biogenesis, Muted-like protein
7	PF00076 RRM_1	4.6e-08	44.1	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
8	PF10779 XhlA	41	15.8	Haemolysin XhlA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010380037.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010374131.1	0.835	Probable ATP-dependent RNA helicase YTHDC2
2	61622.XP_010354132.1	0.825	RNA-binding protein 25
3	61622.XP_010383686.1	0.747	pre-mRNA processing factor 40 homolog B
4	61622.XP_010351614.1	0.718	Belongs to the actin family.
5	61622.XP_010362303.1	0.710	Aminoadipate aminotransferase
6	61622.XP_010370033.1	0.688	Vacuolar protein sorting 13 homolog D
7	61622.XP_010369761.1	0.675	Telomerase is a ribonucleoprotein enzyme essential for the replication of chromosome termini in most eukaryotes. Active in progenitor and cancer cells. Inactive, or very low activity, in normal somatic cells. Catalytic component of the teleromerase holoenzyme complex whose main activity is the elongation of telomeres by acting as a reverse transcriptase that adds simple sequence repeats to chromosome ends by copying a template sequence within the RNA component of the enzyme. Catalyzes the RNA-dependent extension of 3'-chromosomal termini with the 6-nucleotide telomeric repeat unit, 5'- [...]
8	61622.XP_010379922.1	0.673	Splicing factor 3b subunit 1
9	61622.XP_010383262.1	0.673	pre-mRNA-processing factor 19
10	61622.XP_010355169.1	0.670	Pleiotropic regulator 1 isoform X1
11	61622.XP_010354187.1	0.668	Heterogeneous nuclear ribonucleoprotein C (C1/C2)
12	61622.XP_010368083.1	0.668	Cell division cycle 5 like
13	61622.XP_010368692.1	0.668	Heterogeneous nuclear ribonucleoprotein C-like
14	61622.XP_010367418.1	0.662	Crooked neck pre-mRNA splicing factor 1
15	61622.XP_010381248.1	0.659	Splicing factor 3B subunit 3
16	61622.XP_010384976.1	0.655	DEAD-box helicase 49
17	61622.XP_010381030.1	0.654	SNW domain-containing protein 1 isoform X1
18	61622.XP_010383377.1	0.654	XPA binding protein 2
19	61622.XP_010366701.1	0.653	DEAD-box helicase 55
20	61622.XP_010371960.1	0.653	RNA binding motif protein 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0042802	0.998	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019219	0.990	regulation of nucleobase-containing compound metabolic process
GO:0009987	0.963	cellular process
GO:0051252	0.950	regulation of RNA metabolic process
GO:0048519	0.878	negative regulation of biological process
GO:0048523	0.830	negative regulation of cellular process
GO:0009892	0.830	negative regulation of metabolic process
GO:0051172	0.816	negative regulation of nitrogen compound metabolic process
GO:1903311	0.795	regulation of mRNA metabolic process
GO:0010605	0.791	negative regulation of macromolecule metabolic process
GO:0045934	0.781	negative regulation of nucleobase-containing compound metabolic process
GO:0071704	0.744	organic substance metabolic process
GO:0044238	0.708	primary metabolic process
GO:1903312	0.705	negative regulation of mRNA metabolic process
GO:0044237	0.696	cellular metabolic process
GO:0006807	0.675	nitrogen compound metabolic process
GO:0043170	0.629	macromolecule metabolic process
GO:1901360	0.541	organic cyclic compound metabolic process
GO:0006725	0.520	cellular aromatic compound metabolic process
GO:0034641	0.486	cellular nitrogen compound metabolic process
GO:0008380	0.476	RNA splicing
GO:0006397	0.435	mRNA processing
GO:0000375	0.426	RNA splicing, via transesterification reactions
GO:0000398	0.410	mRNA splicing, via spliceosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.723	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]