StarFunc result for job id Q86SH2

User Input

>input (424 residues)
MAALGDEVLDGYVFPACPPCSYRYPYPAATKGKGAAGGSWQQRGRGCLPASSPCSAGAAS
LSFPGCGRLTAAEYFDSYQRERLMALLAQVGPGLGPRARRAGSCDVAVQVSPRIDAAVQC
SLGRRTLQRRARDPESPAGPGAEGTTGGGSFSQQPSRRGLEQGSPQNGAPRPMRFPRTVA
VYSPLALRRLTAFLEGPGPAAGEQRSGASDGERGPPPARLQGPEEGEVWTKKAPRRPQSD
DDGEAQAAVRASWEQPADGPELPPREAQEGEAAPRSALRSPGQPPSAGRARDGGDGREAA
VAGEGPSPRSPELGKERLRFQFLEQKYGYYHCKDCNIRWESAYVWCVQGTNKVYFKQFCR
TCQKSYNPYRVEDITCQSCKQTRCSCPVKLRHVDPKRPHRQDLCGRCKGKRLSCDSTFSF
KYII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86SH2	1.000	1.000	1.824E-68	424	1.000	1.000	Q86SH2.pdb.gz	ZAR1_HUMAN Zygote arrest protein 1 OS=Homo sapiens OX=9606 GN=ZAR1 PE=1 SV=1
2	AFDB:Q4ZGL5	0.074	0.059	3.615E-2	596	0.149	0.106	Q4ZGL5.pdb.gz
3	AFDB:E7FCN3	0.087	0.066	5.310E-2	649	0.170	0.111	E7FCN3.pdb.gz
4	AFDB:D9PTN5	0.081	0.041	2.810E-1	1009	0.130	0.055	D9PTN5.pdb.gz	MYRF2_CAEEL Myelin regulatory factor homolog 2 OS=Caenorhabditis elegans OX=6239 GN=myrf-2 PE=1 SV=1
5	AFDB:D4A6E4	0.089	0.053	2.996E-1	762	0.113	0.063	D4A6E4.pdb.gz	D4A6E4_RAT Enhancer of polycomb homolog 1 OS=Rattus norvegicus OX=10116 GN=Epc1 PE=1 SV=3
6	AFDB:Q8CIB9	0.061	0.047	3.631E-1	592	0.139	0.100	Q8CIB9.pdb.gz	ESCO2_MOUSE N-acetyltransferase ESCO2 OS=Mus musculus OX=10090 GN=Esco2 PE=1 SV=3
7	PDB:6wgg2	0.083	0.063	6.349E-1	581	0.028	0.021	6wgg2.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
8	AFDB:Q6NW12	0.093	0.093	6.464E-1	425	0.116	0.115	Q6NW12.pdb.gz	Q6NW12_HUMAN TANK protein OS=Homo sapiens OX=9606 GN=TANK PE=1 SV=1
9	AFDB:A6NDB9	0.069	0.047	7.349E-1	673	0.163	0.103	A6NDB9.pdb.gz	PALM3_HUMAN Paralemmin-3 OS=Homo sapiens OX=9606 GN=PALM3 PE=1 SV=2
10	AFDB:A0A024R099	0.074	0.101	9.496E-1	333	0.146	0.186	A0A024R099.pdb.gz
11	AFDB:Q5ZQU2	0.069	0.038	1.012	815	0.184	0.096	Q5ZQU2.pdb.gz	NPAS2_CHICK Neuronal PAS domain-containing protein 2 OS=Gallus gallus OX=9031 GN=NPAS2 PE=1 SV=1
12	PDB:7pfo4	0.077	0.054	1.205	619	0.017	0.011	7pfo4.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
13	PDB:6wgi4	0.069	0.049	1.887	650	0.017	0.011	6wgi4.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
14	PDB:6wgg7	0.076	0.053	3.152	641	0.012	0.008	6wgg7.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
15	PDB:6xtx4	0.072	0.053	4.630	598	0.017	0.012	6xtx4.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
16	PDB:7p2pB	0.041	0.067	4.630	179	0.024	0.056	7p2pB.pdb.gz
17	PDB:7v3u7	0.076	0.050	5.982	699	0.012	0.007	7v3u7.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
18	PDB:3cl5A	0.039	0.046	6.800	358	0.009	0.011	3cl5A.pdb.gz	Structure of coronavirus hemagglutinin-esterase offers insight into corona and influenza virus evolution.
19	PDB:6wgf4	0.071	0.051	6.800	636	0.017	0.011	6wgf4.pdb.gz
20	PDB:7oqyY	0.061	0.197	6.800	92	0.033	0.152	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86SH2	0.0	846	424	1.000	1.000	ZAR1_HUMAN Zygote arrest protein 1 OS=Homo sapiens OX=9606 GN=ZAR1 PE=1 SV=1
2	Q80SU3	4.61e-112	335	361	0.514	0.604	ZAR1_MOUSE Zygote arrest protein 1 OS=Mus musculus OX=10090 GN=Zar1 PE=1 SV=1
3	Q7T3U0	8.98e-99	298	295	0.453	0.651	ZAR1S_XENLA Zygote arrest protein 1.S OS=Xenopus laevis OX=8355 GN=zar1.S PE=1 SV=1
4	Q7T3T8	1.70e-91	281	329	0.370	0.477	ZAR1_DANRE Zygote arrest protein 1 OS=Danio rerio OX=7955 GN=zar1 PE=1 SV=1
5	K7SGN7	1.63e-75	239	307	0.342	0.472	ZAR2B_XENLA Zygote arrest protein 2.L OS=Xenopus laevis OX=8355 GN=zar2.L PE=1 SV=2
6	C0SPG1	3.07e-56	189	302	0.186	0.262	ZAR2A_XENLA Zygote arrest protein 2.S OS=Xenopus laevis OX=8355 GN=zar2.S PE=1 SV=1
7	A0A1L8HBI7	5.40e-53	180	281	0.205	0.310	ZA1LS_XENLA Protein ZAR1-like 1.S OS=Xenopus laevis OX=8355 GN=zar1l.S PE=1 SV=1
8	C3VD30	6.13e-47	164	291	0.215	0.313	ZAR1L_MOUSE Protein ZAR1-like OS=Mus musculus OX=10090 GN=Zar1l PE=1 SV=1
9	Q38DX3	0.003	39.7	114	0.047	0.175	Q38DX3_TRYB2 3CxxC-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1810 PE=4 SV=1
10	Q4VA53	0.48	35.4	1446	0.075	0.022	PDS5B_MOUSE Sister chromatid cohesion protein PDS5 homolog B OS=Mus musculus OX=10090 GN=Pds5b PE=1 SV=1
11	Q768S2	1.2	33.1	184	0.040	0.092	Q768S2_DROME Rabphilin (Fragment) OS=Drosophila melanogaster OX=7227 GN=Rph PE=2 SV=1
12	Q9W2R9	1.2	33.9	638	0.040	0.027	Q9W2R9_DROME Rabphilin, isoform A OS=Drosophila melanogaster OX=7227 GN=Rph PE=4 SV=2
13	Q06277	1.9	33.5	4095	0.144	0.015	IBPA_HISS2 Protein adenylyltransferase and cysteine protease IbpA OS=Histophilus somni (strain 2336) OX=228400 GN=ibpA PE=1 SV=2
14	O75962	2.7	33.1	3097	0.106	0.015	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
15	Q71M36	2.9	32.7	566	0.061	0.046	CSPG5_MOUSE Chondroitin sulfate proteoglycan 5 OS=Mus musculus OX=10090 GN=Cspg5 PE=1 SV=2
16	Q38BU4	4.8	32.0	1223	0.052	0.018	Q38BU4_TRYB2 Bilobe protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4540 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13695 zf-3CxxC	1.3e-05	36.9	Zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329803

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367942	0.914	Growth/differentiation factor 9
2	9606.ENSP00000381032	0.892	Nucleoplasmin-2
3	9606.ENSP00000252677	0.772	Bone morphogenetic protein 15
4	9606.ENSP00000375063	0.765	NACHT, LRR and PYD domains-containing protein 5
5	9606.ENSP00000319799	0.742	Histone H1oo
6	9606.ENSP00000348300	0.733	Protein BTG4
7	9606.ENSP00000483125	0.733	Protein-arginine deiminase type-6
8	9606.ENSP00000378326	0.699	Zona pellucida sperm-binding protein 3
9	9606.ENSP00000333097	0.659	Factor in the germline alpha
10	9606.ENSP00000460971	0.651	Zona pellucida sperm-binding protein 2
11	9606.ENSP00000380675	0.643	Wee1-like protein kinase 2
12	9606.ENSP00000419457	0.626	Homeobox protein NOBOX
13	9606.ENSP00000273861	0.609	Sodium/bile acid cotransporter 4
14	9606.ENSP00000485526	0.603	Ras association domain family member 10
15	9606.ENSP00000446485	0.563	Gametocyte-specific factor 1
16	9606.ENSP00000359384	0.561	Oocyte-expressed protein homolog
17	9606.ENSP00000360252	0.552	Protein Hook homolog 1
18	9606.ENSP00000278853	0.545	Zona pellucida sperm-binding protein 1
19	9606.ENSP00000482304	0.541	Zona pellucida sperm-binding protein 4
20	9606.ENSP00000309233	0.540	POM121 and ZP3 fusion

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.988	nucleic acid binding
GO:0003729	0.962	mRNA binding
GO:0003730	0.514	mRNA 3'-UTR binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0080090	0.994	regulation of primary metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0009987	0.990	cellular process
GO:0010556	0.990	regulation of macromolecule biosynthetic process
GO:0048523	0.989	negative regulation of cellular process
GO:0031326	0.989	regulation of cellular biosynthetic process
GO:0051246	0.984	regulation of protein metabolic process
GO:0010608	0.977	post-transcriptional regulation of gene expression
GO:0032502	0.976	developmental process
GO:0051172	0.971	negative regulation of nitrogen compound metabolic process
GO:0010605	0.968	negative regulation of macromolecule metabolic process
GO:0031324	0.968	negative regulation of cellular metabolic process
GO:0010629	0.953	negative regulation of gene expression
GO:0051248	0.953	negative regulation of protein metabolic process
GO:0010558	0.932	negative regulation of macromolecule biosynthetic process
GO:0006417	0.932	regulation of translation
GO:0031327	0.928	negative regulation of cellular biosynthetic process
GO:0032501	0.920	multicellular organismal process
GO:0000003	0.900	reproduction
GO:0048518	0.883	positive regulation of biological process
GO:0048856	0.829	anatomical structure development
GO:0022414	0.826	reproductive process
GO:0019953	0.794	sexual reproduction
GO:0019219	0.656	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.654	regulation of RNA metabolic process
GO:0048869	0.625	cellular developmental process
GO:0030154	0.621	cell differentiation
GO:0034249	0.592	negative regulation of amide metabolic process
GO:0048522	0.566	positive regulation of cellular process
GO:0048468	0.566	cell development
GO:0017148	0.563	negative regulation of translation
GO:0009893	0.561	positive regulation of metabolic process
GO:0007292	0.561	female gamete generation
GO:0003006	0.544	developmental process involved in reproduction
GO:0010604	0.538	positive regulation of macromolecule metabolic process
GO:0048477	0.460	oogenesis
GO:0009994	0.442	oocyte differentiation
GO:0048599	0.422	oocyte development
GO:0048469	0.390	cell maturation
GO:0071704	0.354	organic substance metabolic process
GO:0071840	0.342	cellular component organization or biogenesis
GO:0044238	0.340	primary metabolic process
GO:0001556	0.338	oocyte maturation
GO:0016043	0.301	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005737	0.987	cytoplasm
GO:0005634	0.797	nucleus
GO:0043233	0.468	organelle lumen
GO:0031981	0.463	nuclear lumen
GO:0032991	0.453	protein-containing complex
GO:0005654	0.449	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]