StarFunc result for job id Q86SJ6

User Input

>input (1040 residues)
MDWLFFRNICLLIILMVVMEVNSEFIVEVKEFDIENGTTKWQTVRRQKREWIKFAAACRE
GEDNSKRNPIAKIRSDCESNQKITYRISGVGIDRPPYGVFTINPRTGEINITSVVDREIT
PLFLIYCRALNSRGEDLERPLELRVKVMDINDNAPVFSQSVYTASIEENSDANTLVVKLC
ATDADEENHLNSKIAYKIVSQEPSGAPMFILNRYTGEVCTMSSFLDREQHSMYNLVVRGS
DRDGAADGLSSECDCRIKVLDVNDNFPTLEKTSYSASIEENCLSSELIRLQAIDLDEEGT
DNWLAQYLILSGNDGNWFDIQTDPQTNEGILKVVKMLDYEQAPNIQLSIGVKNQADFHYS
VASQFQMHPTPVRIQVVDVREGPAFHPSTMAFSVREGIKGSSLLNYVLGTYTAIDLDTGN
PATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTAT
GTICIEVPDINDYCPNIFPERRTICIDSPSVLISVNEHSYGSPFTFCVVDEPPGIADMWD
VRSTNATSAILTAKQVLSPGFYEIPILVKDSYNRACELAQMVQLYACDCDDNHMCLDSGA
AGIYTEDITGDTYGPVTEDQAGVSNVGLGPAGIGMMVLGILLLILAPLLLLLCCCKQRQP
EGLGTRFAPVPEGGEGVMQSWRIEGAHPEDRDVSNICAPMTASNTQDRMDSSEIYTNTYA
AGGTVEGGVSGVELNTGMGTAVGLMAAGAAGASGAARKRSSTMGTLRDYADADINMAFLD
SYFSEKAYAYADEDEGRPANDCLLIYDHEGVGSPVGSIGCCSWIVDDLDESCMETLDPKF
RTLAEICLNTEIEPFPSHQACIPISTDLPLLGPNYFVNESSGLTPSEVEFQEEMAASEPV
VHGDIIVTETYGNADPCVQPTTIIFDPQLAPNVVVTEAVMAPVYDIQGNICVPAELADYN
NVIYAERVLASPGVPDMSNSSTTEGCMGPVMSGNILVGPEIQVMQMMSPDLPIGQTVGST
SPMTSRHRVTRYSNIHYTQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TMD7	0.628	0.627	0.000	1041	0.825	0.824	Q7TMD7.pdb.gz	DSG4_MOUSE Desmoglein-4 OS=Mus musculus OX=10090 GN=Dsg4 PE=1 SV=1
2	AFDB:Q86SJ6	1.000	1.000	0.000	1040	1.000	1.000	Q86SJ6.pdb.gz	DSG4_HUMAN Desmoglein-4 OS=Homo sapiens OX=9606 GN=DSG4 PE=1 SV=1
3	AFDB:O35902	0.480	0.501	4.349E-104	993	0.451	0.472	O35902.pdb.gz	DSG3_MOUSE Desmoglein-3 OS=Mus musculus OX=10090 GN=Dsg3 PE=2 SV=1
4	AFDB:D3ZM39	0.447	0.439	8.436E-92	1060	0.436	0.427	D3ZM39.pdb.gz	D3ZM39_RAT Desmoglein 1 OS=Rattus norvegicus OX=10116 GN=Dsg1 PE=4 SV=1
5	AFDB:Q02413	0.453	0.449	2.877E-91	1049	0.425	0.421	Q02413.pdb.gz	DSG1_HUMAN Desmoglein-1 OS=Homo sapiens OX=9606 GN=DSG1 PE=1 SV=2
6	AFDB:Q03763	0.453	0.451	2.877E-91	1043	0.424	0.423	Q03763.pdb.gz	DSG1_BOVIN Desmoglein-1 OS=Bos taurus OX=9913 GN=DSG1 PE=1 SV=1
7	AFDB:Q7TSF1	0.424	0.416	7.859E-90	1060	0.435	0.426	Q7TSF1.pdb.gz	DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus OX=10090 GN=Dsg1b PE=1 SV=1
8	AFDB:Q7TSF0	0.445	0.503	2.306E-84	911	0.400	0.457	Q7TSF0.pdb.gz	DSG1C_MOUSE Desmoglein-1-gamma OS=Mus musculus OX=10090 GN=Dsg1c PE=1 SV=1
9	AFDB:F1LYX9	0.516	0.479	3.349E-84	1128	0.383	0.353	F1LYX9.pdb.gz	F1LYX9_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=2
10	AFDB:Q14126	0.484	0.452	3.471E-82	1118	0.366	0.341	Q14126.pdb.gz	DSG2_HUMAN Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2
11	PDB:6velC	0.194	0.924	2.717E-21	209	0.075	0.373	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
12	PDB:4aq1A	0.107	0.137	1.638E-12	721	0.069	0.100	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:1e07A	0.122	0.168	5.791E-10	642	0.064	0.104	1e07A.pdb.gz
14	PDB:5oj2B	0.124	0.169	2.318E-9	692	0.053	0.079	5oj2B.pdb.gz
15	PDB:4rtdA	0.071	0.067	2.298E-8	1122	0.067	0.062	4rtdA.pdb.gz
16	PDB:5a42A	0.081	0.063	4.358E-8	1597	0.064	0.042	5a42A.pdb.gz
17	PDB:4lnvB	0.072	0.071	7.430E-8	1063	0.051	0.050	4lnvB.pdb.gz
18	PDB:6dldD	0.113	0.283	3.309E-7	269	0.047	0.182	6dldD.pdb.gz
19	PDB:7q5zA	0.085	0.070	1.324E-6	1344	0.052	0.040	7q5zA.pdb.gz
20	PDB:7nycA	0.090	0.067	2.140E-6	1542	0.058	0.039	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AG90	0.0	597	1131	0.377	0.347	A0A8I6AG90_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=1
2	D3ZM39	0.0	582	1060	0.276	0.271	D3ZM39_RAT Desmoglein 1 OS=Rattus norvegicus OX=10116 GN=Dsg1 PE=4 SV=1
3	F1LYX9	0.0	600	1128	0.377	0.348	F1LYX9_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=2
4	O35902	0.0	884	993	0.457	0.478	DSG3_MOUSE Desmoglein-3 OS=Mus musculus OX=10090 GN=Dsg3 PE=2 SV=1
5	O55111	0.0	592	1122	0.372	0.345	DSG2_MOUSE Desmoglein-2 OS=Mus musculus OX=10090 GN=Dsg2 PE=1 SV=3
6	P32926	0.0	906	999	0.486	0.506	DSG3_HUMAN Desmoglein-3 OS=Homo sapiens OX=9606 GN=DSG3 PE=1 SV=2
7	Q02413	0.0	621	1049	0.276	0.274	DSG1_HUMAN Desmoglein-1 OS=Homo sapiens OX=9606 GN=DSG1 PE=1 SV=2
8	Q03763	0.0	605	1043	0.272	0.271	DSG1_BOVIN Desmoglein-1 OS=Bos taurus OX=9913 GN=DSG1 PE=1 SV=1
9	Q14126	0.0	592	1118	0.372	0.346	DSG2_HUMAN Desmoglein-2 OS=Homo sapiens OX=9606 GN=DSG2 PE=1 SV=2
10	Q61495	0.0	602	1057	0.276	0.272	DSG1A_MOUSE Desmoglein-1-alpha OS=Mus musculus OX=10090 GN=Dsg1a PE=2 SV=2
11	Q6W3B0	0.0	1739	1040	0.820	0.820	DSG4_RAT Desmoglein-4 OS=Rattus norvegicus OX=10116 GN=Dsg4 PE=1 SV=1
12	Q7TMD7	0.0	1781	1041	0.826	0.825	DSG4_MOUSE Desmoglein-4 OS=Mus musculus OX=10090 GN=Dsg4 PE=1 SV=1
13	Q7TSF0	0.0	562	911	0.263	0.300	DSG1C_MOUSE Desmoglein-1-gamma OS=Mus musculus OX=10090 GN=Dsg1c PE=1 SV=1
14	Q7TSF1	0.0	601	1060	0.276	0.271	DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus OX=10090 GN=Dsg1b PE=1 SV=1
15	Q86SJ6	0.0	2153	1040	1.000	1.000	DSG4_HUMAN Desmoglein-4 OS=Homo sapiens OX=9606 GN=DSG4 PE=1 SV=1
16	H2EQR6	9.78e-130	424	1142	0.303	0.276	DSG21_DANRE Desmoglein-2.1 OS=Danio rerio OX=7955 GN=dsg2.1 PE=2 SV=1
17	P55850	5.20e-104	348	896	0.240	0.279	DSC3_MOUSE Desmocollin-3 OS=Mus musculus OX=10090 GN=Dsc3 PE=1 SV=3
18	Q02487	2.00e-102	344	901	0.247	0.285	DSC2_HUMAN Desmocollin-2 OS=Homo sapiens OX=9606 GN=DSC2 PE=1 SV=1
19	A0A3B3ISU0	8.71e-101	336	758	0.239	0.328	A0A3B3ISU0_HUMAN Desmocollin 2 OS=Homo sapiens OX=9606 GN=DSC2 PE=1 SV=1
20	Q08554	6.48e-100	337	894	0.252	0.293	DSC1_HUMAN Desmocollin-1 OS=Homo sapiens OX=9606 GN=DSC1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	8.1e-58	204.2	Cadherin domain
2	PF16184 Cadherin_3	22	16.4	Cadherin-like
3	PF01049 CADH_Y-type_LIR	0.0048	28.3	Cadherin, Y-type LIR-motif
4	PF18957 RibLong	1.6e+02	14.5	Long Rib domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000010203

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000000412	0.843	Plakophilin 1
2	9601.ENSPPYP00000009456	0.834	Junction plakoglobin
3	9601.ENSPPYP00000018130	0.825	Desmoplakin
4	9601.ENSPPYP00000003328	0.817	Plakophilin 3
5	9601.ENSPPYP00000005030	0.810	Plakophilin 2
6	9601.ENSPPYP00000014360	0.689	Plakophilin 4
7	9601.ENSPPYP00000018676	0.645	Cysteine-rich secretory protein 1
8	9601.ENSPPYP00000010546	0.643	SH3-domain GRB2-like 1
9	9601.ENSPPYP00000003748	0.639	Catenin delta 1
10	9601.ENSPPYP00000015644	0.622	Uncharacterized protein DKFZp469E1714
11	9601.ENSPPYP00000020565	0.610	BLK proto-oncogene, Src family tyrosine kinase
12	9601.ENSPPYP00000019085	0.597	PERP, TP53 apoptosis effector
13	9601.ENSPPYP00000015772	0.589	Calcium-transporting ATPase type 2C member 1
14	9601.ENSPPYP00000010201	0.579	Desmocollin 1
15	9601.ENSPPYP00000001339	0.557	Glomulin, FKBP associated protein
16	9601.ENSPPYP00000010200	0.550	Desmocollin 2
17	9601.ENSPPYP00000010199	0.549	Desmocollin 3
18	9601.ENSPPYP00000017145	0.540	Catenin delta 2
19	9601.ENSPPYP00000006228	0.535	Solute carrier family 15 (oligopeptide transporter), member 1
20	9601.ENSPPYP00000005185	0.531	Keratin 85

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043167	0.815	ion binding
GO:0043169	0.797	cation binding
GO:0046872	0.727	metal ion binding
GO:0005509	0.708	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0007155	0.970	cell adhesion
GO:0065007	0.584	biological regulation
GO:0032502	0.539	developmental process
GO:0048856	0.447	anatomical structure development
GO:0050789	0.439	regulation of biological process
GO:0050794	0.300	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030054	0.981	cell junction
GO:0005911	0.972	cell-cell junction
GO:0001533	0.966	cornified envelope
GO:0005622	0.947	intracellular anatomical structure
GO:0005737	0.940	cytoplasm
GO:0030057	0.912	desmosome
GO:0043226	0.768	organelle
GO:0043227	0.717	membrane-bounded organelle
GO:0043229	0.701	intracellular organelle
GO:0005576	0.622	extracellular region
GO:0005829	0.428	cytosol
GO:0070062	0.314	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]