StarFunc result for job id Q86SK9

User Input

>input (330 residues)
MPGPATDAGKIPFCDAKEEIRAGLESSEGGGGPERPGARGQRQNIVWRNVVLMSLLHLGA
VYSLVLIPKAKPLTLLWAYFCFLLAALGVTAGAHRLWSHRSYRAKLPLRIFLAVANSMAF
QNDIFEWSRDHRAHHKYSETDADPHNARRGFFFSHIGWLFVRKHRDVIEKGRKLDVTDLL
ADPVVRIQRKYYKISVVLMCFVVPTLVPWYIWGESLWNSYFLASILRYTISLNISWLVNS
AAHMYGNRPYDKHISPRQNPLVALGAIGEGFHNYHHTFPFDYSASEFGLNFNPTTWFIDF
MCWLGLATDRKRATKPMIEARKARTGDSSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86SK9	1.000	1.000	6.031E-51	330	1.000	1.000	Q86SK9.pdb.gz	SCD5_HUMAN Stearoyl-CoA desaturase 5 OS=Homo sapiens OX=9606 GN=SCD5 PE=1 SV=2
2	AFDB:W5PZ56	0.872	0.787	3.176E-35	366	0.591	0.533	W5PZ56.pdb.gz	W5PZ56_SHEEP stearoyl-CoA 9-desaturase OS=Ovis aries OX=9940 GN=SCD PE=3 SV=1
3	AFDB:O00767	0.879	0.809	4.379E-35	359	0.579	0.532	O00767.pdb.gz	SCD_HUMAN Stearoyl-CoA desaturase OS=Homo sapiens OX=9606 GN=SCD PE=1 SV=2
4	AFDB:P07308	0.882	0.814	1.000E-34	358	0.585	0.539	P07308.pdb.gz	ACOD1_RAT Acyl-CoA desaturase 1 OS=Rattus norvegicus OX=10116 GN=Scd1 PE=1 SV=2
5	AFDB:P13011	0.873	0.805	1.047E-34	358	0.573	0.528	P13011.pdb.gz	SCD2_MOUSE Stearoyl-CoA desaturase 2 OS=Mus musculus OX=10090 GN=Scd2 PE=1 SV=2
6	AFDB:Q99PL7	0.871	0.800	1.990E-34	359	0.561	0.515	Q99PL7.pdb.gz	SCD3_MOUSE Acyl-CoA desaturase 3 OS=Mus musculus OX=10090 GN=Scd3 PE=1 SV=1
7	PDB:4ymkA	0.880	0.902	7.972E-34	322	0.564	0.578	4ymkA.pdb.gz	X-ray structure of a mammalian stearoyl-CoA desaturase.
8	AFDB:Q6T707	0.879	0.823	3.269E-33	353	0.536	0.501	Q6T707.pdb.gz	SCD4_MOUSE Stearoyl-CoA desaturase 4 OS=Mus musculus OX=10090 GN=Scd4 PE=1 SV=1
9	AFDB:Q7K4Y0	0.876	0.756	1.078E-32	383	0.503	0.433	Q7K4Y0.pdb.gz	Q7K4Y0_DROME Desaturase 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Desat1 PE=1 SV=1
10	AFDB:Q6US81	0.870	0.850	3.861E-31	338	0.482	0.470	Q6US81.pdb.gz	ACO11_SPOLI Acyl-CoA Delta(11) desaturase OS=Spodoptera littoralis OX=7109 PE=1 SV=1
11	AFDB:Q75PL7	0.866	0.866	1.100E-29	330	0.473	0.473	Q75PL7.pdb.gz	DESAT_BOMMO (11Z)-hexadec-11-enoyl-CoA conjugase OS=Bombyx mori OX=7091 GN=desat1 PE=1 SV=1
12	PDB:7oixB	0.203	0.166	6.592E-1	451	0.121	0.089	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.
13	PDB:7n98A	0.212	0.167	1.092	473	0.076	0.053	7n98A.pdb.gz
14	PDB:4rp9A	0.155	0.119	1.312	451	0.106	0.078	4rp9A.pdb.gz	Crystal structure of a phosphorylation-coupled vitamin C transporter.
15	PDB:5nx7A	0.169	0.177	1.576	308	0.073	0.078	5nx7A.pdb.gz	Structural Basis of Catalysis in the Bacterial Monoterpene Synthases Linalool Synthase and 1,8-Cineole Synthase.
16	PDB:5w81A	0.172	0.063	1.983	1173	0.103	0.029	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.
17	PDB:6yupD	0.091	0.091	2.275	328	0.088	0.088	6yupD.pdb.gz	Structural basis for amino acid exchange by a human heteromeric amino acid transporter.
18	PDB:6ji1A	0.137	0.109	2.382	462	0.094	0.067	6ji1A.pdb.gz
19	PDB:7p46A	0.106	0.113	2.494	281	0.103	0.121	7p46A.pdb.gz	Binding of l-kynurenine to X. campestris tryptophan 2,3-dioxygenase.
20	PDB:7p5jA	0.105	0.091	2.494	399	0.100	0.083	7p5jA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86SK9	0.0	685	330	1.000	1.000	SCD5_HUMAN Stearoyl-CoA desaturase 5 OS=Homo sapiens OX=9606 GN=SCD5 PE=1 SV=2
2	C0JXB7	9.15e-145	414	359	0.567	0.521	C0JXB7_SHEEP stearoyl-CoA 9-desaturase OS=Ovis aries OX=9940 GN=SCD PE=3 SV=1
3	W5PZ56	1.15e-144	414	366	0.567	0.511	W5PZ56_SHEEP stearoyl-CoA 9-desaturase OS=Ovis aries OX=9940 GN=SCD PE=3 SV=1
4	O62849	2.88e-144	413	359	0.567	0.521	ACOD_SHEEP Acyl-CoA desaturase OS=Ovis aries OX=9940 GN=SCD PE=2 SV=1
5	Q9TT94	1.75e-143	411	359	0.564	0.518	SCD_BOVIN Stearoyl-CoA desaturase OS=Bos taurus OX=9913 GN=SCD PE=2 SV=2
6	Q867D1	2.99e-143	410	359	0.564	0.518	Q867D1_BOVIN stearoyl-CoA 9-desaturase OS=Bos taurus OX=9913 GN=Scd PE=2 SV=1
7	P07308	3.88e-143	410	358	0.591	0.545	ACOD1_RAT Acyl-CoA desaturase 1 OS=Rattus norvegicus OX=10116 GN=Scd1 PE=1 SV=2
8	O00767	1.72e-142	408	359	0.579	0.532	SCD_HUMAN Stearoyl-CoA desaturase OS=Homo sapiens OX=9606 GN=SCD PE=1 SV=2
9	P13516	2.27e-142	408	355	0.579	0.538	ACOD1_MOUSE Acyl-CoA desaturase 1 OS=Mus musculus OX=10090 GN=Scd1 PE=1 SV=2
10	P13011	1.26e-140	404	358	0.555	0.511	SCD2_MOUSE Stearoyl-CoA desaturase 2 OS=Mus musculus OX=10090 GN=Scd2 PE=1 SV=2
11	Q99PL7	1.86e-140	403	359	0.564	0.518	SCD3_MOUSE Acyl-CoA desaturase 3 OS=Mus musculus OX=10090 GN=Scd3 PE=1 SV=1
12	Q6P7B9	2.22e-140	403	358	0.573	0.528	SCD2_RAT Stearoyl-CoA desaturase 2 OS=Rattus norvegicus OX=10116 GN=Scd2 PE=1 SV=1
13	Q6T707	2.81e-133	385	353	0.524	0.490	SCD4_MOUSE Stearoyl-CoA desaturase 4 OS=Mus musculus OX=10090 GN=Scd4 PE=1 SV=1
14	Q9U972	1.08e-115	341	383	0.476	0.410	Q9U972_DROME Fatty acid desaturase OS=Drosophila melanogaster OX=7227 GN=Desat1 PE=2 SV=1
15	Q7K4Y0	1.44e-115	341	383	0.479	0.413	Q7K4Y0_DROME Desaturase 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Desat1 PE=1 SV=1
16	Q94541	2.22e-114	338	383	0.476	0.410	Q94541_DROME Fatty acid desaturase OS=Drosophila melanogaster OX=7227 GN=Desat1 PE=2 SV=1
17	Q6US81	2.41e-112	331	338	0.470	0.459	ACO11_SPOLI Acyl-CoA Delta(11) desaturase OS=Spodoptera littoralis OX=7109 PE=1 SV=1
18	Q75PL7	1.00e-103	309	330	0.470	0.470	DESAT_BOMMO (11Z)-hexadec-11-enoyl-CoA conjugase OS=Bombyx mori OX=7091 GN=desat1 PE=1 SV=1
19	Q9VTD4	6.02e-103	308	355	0.430	0.400	Q9VTD4_DROME Fad2 OS=Drosophila melanogaster OX=7227 GN=Fad2 PE=3 SV=1
20	Q8ISS3	9.35e-103	306	335	0.448	0.442	ACO11_CHORO Acyl-CoA Delta(11) desaturase OS=Choristoneura rosaceana OX=27543 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00487 FA_desaturase	1.5e-11	56.2	Fatty acid desaturase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316329

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266041	0.989	Inter-alpha-trypsin inhibitor heavy chain H4
2	9606.ENSP00000011653	0.974	T-cell surface glycoprotein CD4
3	9606.ENSP00000354476	0.953	Sterol regulatory element-binding protein 2
4	9606.ENSP00000378105	0.933	Elongation of very long chain fatty acids protein 6
5	9606.ENSP00000311224	0.927	Acyl-coenzyme A thioesterase 1
6	9606.ENSP00000238651	0.919	Acyl-coenzyme A thioesterase 2, mitochondrial
7	9606.ENSP00000242480	0.915	E3 SUMO-protein ligase EGR2
8	9606.ENSP00000323071	0.909	Acyl-coenzyme A thioesterase 4
9	9606.ENSP00000373153	0.878	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2
10	9606.ENSP00000278353	0.877	Very-long-chain 3-oxoacyl-CoA reductase
11	9606.ENSP00000355308	0.874	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 1
12	9606.ENSP00000261875	0.866	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3
13	9606.ENSP00000419503	0.860	Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 4
14	9606.ENSP00000215567	0.858	Very-long-chain enoyl-CoA reductase
15	9606.ENSP00000292303	0.832	C-C chemokine receptor type 5
16	9606.ENSP00000359380	0.809	Acyl-CoA desaturase
17	9606.ENSP00000265162	0.793	Glutamyl aminopeptidase
18	9606.ENSP00000419945	0.782	Syncytin-1
19	9606.ENSP00000265276	0.776	Glycerol-3-phosphate acyltransferase 1, mitochondrial
20	9606.ENSP00000304592	0.752	Fatty acid synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004768	1.000	stearoyl-CoA 9-desaturase activity
GO:0005488	0.811	binding
GO:0005515	0.731	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0006629	0.996	lipid metabolic process
GO:1901576	0.992	organic substance biosynthetic process
GO:0044249	0.987	cellular biosynthetic process
GO:0006631	0.960	fatty acid metabolic process
GO:0008610	0.906	lipid biosynthetic process
GO:0006633	0.885	fatty acid biosynthetic process
GO:0033559	0.714	unsaturated fatty acid metabolic process
GO:0006636	0.614	unsaturated fatty acid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0031090	0.995	organelle membrane
GO:0005789	0.979	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19721	1.000	2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 + octadecanoyl-CoA = (9Z)-octadecenoyl-CoA + 2 Fe(III)-[cytochrome b5] + 2 H2O
EC:1.14.19.1	1.000	stearoyl-CoA 9-desaturase.

[back to server]