StarFunc result for job id Q86SQ0

User Input

>input (1253 residues)
MEEHSYIQKELDLQNGSLEEDSVVHSVENDSQNMMESLSPKKYSSSLRFKANGDYSGSYL
TLSQPVPAKRSPSPLGTSVRSSPSLAKIQGSKQFSYDGTDKNIPMKPPTPLLNTTSSLSG
YPLGRADFDHYTGRDSERALRLSEKPPYSKYSSRHKSHDNVYSLGGLEGRKASGSLLAMW
NGSSLSDAGPPPISRSGAASMPSSPKQARKMSIQDSLALQPKLTRHKELASENINLRTRK
YSSSSLSHMGAYSRSLPRLYRATENQLTPLSLPPRNSLGNSKRTKLGEKDLPHSVIDNDN
YLNFSSLSSGALPYKTSASEGNPYVSSTLSVPASPRVARKMLLASTSSCASDDFDQASYV
GTNPSHSLLAGESDRVFATRRNFSCGSVEFDEADLESLRQASGTPQPALRERKSSISSIS
GRDDLMDYHRRQREERLREQEMERLERQRLETILSLCAEYTKPDSRLSTGTTVEDVQKIN
KELEKLQLSDEESVFEEALMSPDTRYRCHRKDSLPDADLASCGSLSQSSASFFTPRSTRN
DELLSDLTRTPPPPSSTFPKASSESSYLSILPKTPEGISEEQRSQELAAMEETRIVILNN
LEELKQKIKDINDQMDESFRELDMECALLDGEQKSETTELMKEKEILDHLNRKIAELEKN
IVGEKTKEKVKLDAEREKLERLQELYSEQKTQLDNCPESMREQLQQQLKRDADLLDVESK
HFEDLEFQQLEHESRLDEEKENLTQQLLREVAEYQRNIVSRKEKISALKKQANHIVQQAQ
REQDHFVKEKNNLIMMLQREKENLCNLEKKYSSLSGGKGFPVNPNTLKEGYISVNEINEP
CGNSTNLSPSTQFPADADAVATEPATAVLASQPQSKEHFRSLEERKKQHKEGLYLSDTLP
RKKTTSSISPHFSSATMGRSITPKAHLPLGQSNSCGSVLPPSLAAMAKDSESRRMLRGYN
HQQMSEGHRQKSEFYNRTASESNVYLNSFHYPDHSYKDQAFDTLSLDSSDSMETSISACS
PDNISSASTSNIARIEEMERLLKQAHAEKTRLLESREREMEAKKRALEEEKRRREILEKR
LQEETSQRQKLIEKEVKIRERQRAQARPLTRYLPVRKEDFDLRSHVETAGHNIDTCYHVS
ITEKTCRGFLIKMGGKIKTWKKRWFVFDRNKRTFSYYADKHETKLKGVIYFQAIEEVYYD
HLKNANKSPNPLLTFSVKTHDRIYYMVAPSPEAMRIWMDVIVTGAEGYTHFLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PFQ4	0.100	0.112	0.000	1115	0.889	0.999	E9PFQ4.pdb.gz	E9PFQ4_HUMAN Pleckstrin homology like domain family B member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
2	AFDB:Q86SQ0	1.000	1.000	0.000	1253	1.000	1.000	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
3	AFDB:Q8K1N2	0.422	0.423	0.000	1249	0.872	0.874	Q8K1N2.pdb.gz	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
4	AFDB:Q86UU1	0.178	0.163	2.570E-48	1377	0.354	0.322	Q86UU1.pdb.gz	PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1 PE=1 SV=1
5	AFDB:E9PDY7	0.046	0.091	7.271E-36	519	0.361	0.871	E9PDY7.pdb.gz	E9PDY7_HUMAN Pleckstrin homology like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
6	AFDB:F4HWC3	0.091	0.085	3.624E-10	1364	0.127	0.117	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1
7	AFDB:Q9W179	0.082	0.064	5.881E-10	1703	0.135	0.099	Q9W179.pdb.gz	Q9W179_DROME Sterile20-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Slik PE=1 SV=2
8	AFDB:Q93073	0.045	0.051	1.581E-7	1101	0.125	0.142	Q93073.pdb.gz	SBP2L_HUMAN Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L PE=1 SV=3
9	AFDB:Q5JRA6	0.050	0.034	2.091E-6	1907	0.152	0.100	Q5JRA6.pdb.gz	TGO1_HUMAN Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3 PE=1 SV=1
10	AFDB:O08815	0.126	0.130	4.440E-6	1206	0.101	0.104	O08815.pdb.gz	SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Slk PE=1 SV=1
11	PDB:6bbpA	0.067	0.156	3.007E-5	520	0.023	0.056	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
12	PDB:3ljuX	0.073	0.233	3.935E-5	373	0.015	0.051	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:6u3eA	0.061	0.184	9.306E-5	397	0.024	0.076	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
14	PDB:4mk0A	0.072	0.138	1.976E-4	631	0.014	0.027	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
15	PDB:4iapA	0.058	0.265	3.384E-4	256	0.015	0.074	4iapA.pdb.gz
16	PDB:4gouA	0.059	0.135	8.533E-3	507	0.006	0.014	4gouA.pdb.gz
17	PDB:5yqrA	0.063	0.247	9.503E-3	268	0.008	0.037	5yqrA.pdb.gz
18	PDB:4mt6A	0.074	0.221	1.058E-2	389	0.012	0.039	4mt6A.pdb.gz
19	PDB:4o9yA	0.098	0.061	1.542E-2	2490	0.024	0.012	4o9yA.pdb.gz
20	PDB:6sueA	0.071	0.041	1.812E-2	2292	0.023	0.013	6sueA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PDY7	0.0	905	519	0.358	0.863	E9PDY7_HUMAN Pleckstrin homology like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
2	E9PFQ4	0.0	2258	1115	0.890	1.000	E9PFQ4_HUMAN Pleckstrin homology like domain family B member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
3	G5E9V3	0.0	1162	581	0.457	0.986	G5E9V3_HUMAN Pleckstrin homology like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
4	Q86SQ0	0.0	2579	1253	1.000	1.000	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
5	Q8K1N2	0.0	2209	1249	0.872	0.875	PHLB2_MOUSE Pleckstrin homology-like domain family B member 2 OS=Mus musculus OX=10090 GN=Phldb2 PE=1 SV=2
6	Q86UU1	7.20e-122	412	1377	0.179	0.163	PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1 PE=1 SV=1
7	Q6NSJ2	1.99e-60	222	640	0.091	0.178	PHLB3_HUMAN Pleckstrin homology-like domain family B member 3 OS=Homo sapiens OX=9606 GN=PHLDB3 PE=1 SV=3
8	Q6ZPE2	4.01e-08	60.5	1867	0.027	0.018	MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus OX=10090 GN=Sbf1 PE=1 SV=2
9	O95248	8.51e-08	59.7	1868	0.027	0.018	MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=4
10	M0RAP5	1.22e-07	58.9	1893	0.027	0.018	M0RAP5_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
11	A0A8I6AD51	1.31e-07	58.9	1875	0.027	0.018	A0A8I6AD51_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
12	H0Y5W8	4.03e-07	56.2	425	0.027	0.080	H0Y5W8_HUMAN SET binding factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=2
13	P54644	7.04e-07	55.8	444	0.025	0.070	KRAC_DICDI RAC family serine/threonine-protein kinase homolog OS=Dictyostelium discoideum OX=44689 GN=pkbA PE=1 SV=1
14	Q8BSM5	2.72e-06	53.9	595	0.028	0.059	GAB3_MOUSE GRB2-associated-binding protein 3 OS=Mus musculus OX=10090 GN=Gab3 PE=1 SV=1
15	Q86WG5	5.97e-06	53.5	1849	0.026	0.018	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
16	E9PXF8	7.26e-06	53.1	1872	0.026	0.018	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
17	Q86IV4	8.80e-06	52.4	458	0.025	0.068	Y4775_DICDI PH domain-containing protein DDB_G0274775 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274775 PE=4 SV=1
18	Q8IVE3	1.11e-05	52.4	1493	0.025	0.021	PKHH2_HUMAN Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2
19	C6JUQ2	1.51e-05	52.0	721	0.028	0.049	C6JUQ2_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=1
20	D3ZAL7	1.63e-05	51.6	724	0.028	0.048	D3ZAL7_RAT GRB2-associated binding protein 1 OS=Rattus norvegicus OX=10116 GN=Gab1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	5.7e-11	54.2	PH domain
2	PF15413 PH_11	17	17.3	Pleckstrin homology domain
3	PF15409 PH_8	1.5	20.4	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000405405

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000468263	0.981	ELKS/Rab6-interacting/CAST family member 1
2	9606.ENSP00000221455	0.970	CLK4-associating serine/arginine rich protein
3	9606.ENSP00000327145	0.930	Filamin-C
4	9606.ENSP00000263710	0.773	CLIP-associating protein 1
5	9606.ENSP00000477725	0.728	KN motif and ankyrin repeat domain-containing protein 1
6	9606.ENSP00000417518	0.715	CLIP-associating protein 2
7	9606.ENSP00000253925	0.670	Liprin-alpha-1
8	9606.ENSP00000307939	0.659	GRIP and coiled-coil domain-containing protein 2
9	9606.ENSP00000358866	0.658	Filamin-A
10	9606.ENSP00000300935	0.640	Ras-related protein Rab-8A
11	9606.ENSP00000479322	0.632	CAP-Gly domain-containing linker protein 1
12	9606.ENSP00000260363	0.607	Kinesin-like protein KIF23
13	9606.ENSP00000416015	0.607	[F-actin]-monooxygenase MICAL3
14	9606.ENSP00000354878	0.552	Kinesin-like protein KIF21A
15	9606.ENSP00000353401	0.539	Homeobox protein cut-like 1
16	9606.ENSP00000225296	0.535	Putative ATP-dependent RNA helicase DHX33
17	9606.ENSP00000381984	0.528	Regulation of nuclear pre-mRNA domain-containing protein 1A
18	9606.ENSP00000314724	0.526	Liprin-beta-1
19	9606.ENSP00000223398	0.516	CAP-Gly domain-containing linker protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0045296	0.985	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.975	regulation of cellular process
GO:0016043	0.906	cellular component organization
GO:0051128	0.880	regulation of cellular component organization
GO:0048522	0.879	positive regulation of cellular process
GO:0048523	0.850	negative regulation of cellular process
GO:0051179	0.848	localization
GO:0006996	0.846	organelle organization
GO:0007010	0.830	cytoskeleton organization
GO:0048583	0.779	regulation of response to stimulus
GO:0044087	0.766	regulation of cellular component biogenesis
GO:0033043	0.765	regulation of organelle organization
GO:0007017	0.711	microtubule-based process
GO:0051641	0.707	cellular localization
GO:0051493	0.694	regulation of cytoskeleton organization
GO:0051130	0.689	positive regulation of cellular component organization
GO:1902903	0.466	regulation of supramolecular fiber organization
GO:0030334	0.425	regulation of cell migration
GO:0051234	0.423	establishment of localization
GO:0032886	0.366	regulation of microtubule-based process
GO:0008104	0.362	protein localization
GO:0030155	0.346	regulation of cell adhesion
GO:0070507	0.335	regulation of microtubule cytoskeleton organization
GO:0050793	0.326	regulation of developmental process
GO:0010639	0.312	negative regulation of organelle organization
GO:0010810	0.310	regulation of cell-substrate adhesion
GO:0110053	0.308	regulation of actin filament organization
GO:0044089	0.307	positive regulation of cellular component biogenesis
GO:0051494	0.303	negative regulation of cytoskeleton organization
GO:0019222	0.300	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.999	cytosol
GO:0045111	0.995	intermediate filament cytoskeleton
GO:0043227	0.812	membrane-bounded organelle
GO:0043231	0.804	intracellular membrane-bounded organelle
GO:0099568	0.447	cytoplasmic region
GO:0005938	0.442	cell cortex
GO:0031252	0.437	cell leading edge
GO:0070013	0.426	intracellular organelle lumen
GO:0099738	0.419	cell cortex region
GO:0045178	0.417	basal part of cell
GO:0031981	0.415	nuclear lumen
GO:0045180	0.412	basal cortex
GO:0030054	0.375	cell junction
GO:0005925	0.371	focal adhesion
GO:0012505	0.341	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]