StarFunc result for job id Q86SQ4

User Input

>input (1221 residues)
MMFRSDRMWSCHWKWKPSPLLFLFALYIMCVPHSVWGCANCRVVLSNPSGTFTSPCYPND
YPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSF
NSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPEL
SAFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPVK
EKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEI
VSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKAESNLSCGSYL
IPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQN
ILRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFHLSAGEDKIKVKRSLEDEPRLVLWA
LLVYNATNNTNLEGKIIQQKLLKNNESLDEGLRLHTVNVRQLGHCLAMEEPKGYYWPSIQ
PSEYVLPCPDKPGFSASRICFYNATNPLVTYWGPVDISNCLKEANEVANQILNLTADGQN
LTSANITNIVEQVKRIVNKEENIDITLGSTLMNIFSNILSSSDSDLLESSSEALKTIDEL
AFKIDLNSTSHVNITTRNLALSVSSLLPGTNAISNFSIGLPSNNESYFQMDFESGQVDPL
ASVILPPNLLENLSPEDSVLVRRAQFTFFNKTGLFQDVGPQRKTLVSYVMACSIGNITIQ
NLKDPVQIKIKHTRTQEVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASETVCLCNHF
THFGVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKLRRDYPSKI
LMNLSTALLFLNLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATFTWMGLEAIHMYIALV
KVFNTYIRRYILKFCIIGWGLPALVVSVVLASRNNNEVYGKESYGKEKGDEFCWIQDPVI
FYVTCAGYFGVMFFLNIAMFIVVMVQICGRNGKRSNRTLREEVLRNLRSVVSLTFLLGMT
WGFAFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKENVQKQWRQHLCCGRFRLADNS
DWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSHTDNVSYEHSF
NKSGSLRQCFHGQVLVKTGPC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:C6KFA3	0.683	0.702	0.000	1185	0.485	0.500	C6KFA3.pdb.gz	AGRG6_DANRE Adhesion G-protein coupled receptor G6 OS=Danio rerio OX=7955 GN=adgrg6 PE=1 SV=1
2	AFDB:Q6F3F9	0.689	0.716	0.000	1165	0.803	0.841	Q6F3F9.pdb.gz	AGRG6_MOUSE Adhesion G-protein coupled receptor G6 OS=Mus musculus OX=10090 GN=Adgrg6 PE=1 SV=1
3	AFDB:Q86SQ4	1.000	1.000	0.000	1221	1.000	1.000	Q86SQ4.pdb.gz	AGRG6_HUMAN Adhesion G-protein coupled receptor G6 OS=Homo sapiens OX=9606 GN=ADGRG6 PE=1 SV=3
4	AFDB:Q8CJ11	0.377	0.446	3.826E-52	1013	0.258	0.311	Q8CJ11.pdb.gz	AGRG2_RAT Adhesion G-protein coupled receptor G2 OS=Rattus norvegicus OX=10116 GN=Adgrg2 PE=1 SV=1
5	AFDB:O95490	0.223	0.192	4.533E-35	1459	0.197	0.164	O95490.pdb.gz	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
6	AFDB:Q9HAR2	0.217	0.187	1.230E-34	1447	0.203	0.171	Q9HAR2.pdb.gz	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
7	AFDB:O88917	0.216	0.177	4.145E-34	1515	0.180	0.145	O88917.pdb.gz	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
8	AFDB:O60241	0.300	0.241	2.449E-32	1585	0.188	0.144	O60241.pdb.gz	AGRB2_HUMAN Adhesion G protein-coupled receptor B2 OS=Homo sapiens OX=9606 GN=ADGRB2 PE=1 SV=2
9	AFDB:Q9QYP2	0.217	0.136	6.938E-32	2144	0.192	0.110	Q9QYP2.pdb.gz	CELR2_RAT Cadherin EGF LAG seven-pass G-type receptor 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Celsr2 PE=1 SV=1
10	AFDB:Q7T024	0.216	0.215	3.769E-31	1224	0.164	0.163	Q7T024.pdb.gz
11	PDB:7durR	0.186	0.578	1.642E-8	371	0.048	0.159	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.
12	PDB:4pbpB	0.137	0.724	3.912E-8	210	0.036	0.210	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
13	PDB:6vn7R	0.190	0.823	5.781E-8	263	0.048	0.221	6vn7R.pdb.gz	Cryo-EM structure of an activated VIP1 receptor-G protein complex revealed by a NanoBiT tethering strategy.
14	PDB:7lciR	0.197	0.574	6.585E-8	393	0.048	0.150	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
15	PDB:7d3sR	0.187	0.786	7.182E-8	266	0.053	0.244	7d3sR.pdb.gz	Structure of the human secretin receptor coupled to an engineered heterotrimeric G protein.
16	PDB:7finR	0.199	0.603	1.108E-7	380	0.044	0.142	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
17	PDB:7tynR	0.189	0.587	1.438E-7	373	0.039	0.129	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
18	PDB:7zl1A	0.138	0.694	1.866E-7	215	0.028	0.158	7zl1A.pdb.gz
19	PDB:1b09A	0.138	0.739	1.948E-7	206	0.032	0.189	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
20	PDB:7cz5R	0.185	0.777	3.279E-7	269	0.046	0.208	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C6KFA3	0.0	1078	1185	0.488	0.503	AGRG6_DANRE Adhesion G-protein coupled receptor G6 OS=Danio rerio OX=7955 GN=adgrg6 PE=1 SV=1
2	Q6F3F9	0.0	1921	1165	0.803	0.841	AGRG6_MOUSE Adhesion G-protein coupled receptor G6 OS=Mus musculus OX=10090 GN=Adgrg6 PE=1 SV=1
3	Q86SQ4	0.0	2521	1221	1.000	1.000	AGRG6_HUMAN Adhesion G-protein coupled receptor G6 OS=Homo sapiens OX=9606 GN=ADGRG6 PE=1 SV=3
4	Q8CJ11	2.81e-166	522	1013	0.220	0.266	AGRG2_RAT Adhesion G-protein coupled receptor G2 OS=Rattus norvegicus OX=10116 GN=Adgrg2 PE=1 SV=1
5	Q8IZP9	4.22e-164	517	1017	0.220	0.265	AGRG2_HUMAN Adhesion G-protein coupled receptor G2 OS=Homo sapiens OX=9606 GN=ADGRG2 PE=1 SV=2
6	Q8IZF6	8.64e-141	476	3080	0.209	0.083	AGRG4_HUMAN Adhesion G-protein coupled receptor G4 OS=Homo sapiens OX=9606 GN=ADGRG4 PE=1 SV=2
7	Q86Y34	6.87e-58	212	549	0.120	0.266	AGRG3_HUMAN Adhesion G protein-coupled receptor G3 OS=Homo sapiens OX=9606 GN=ADGRG3 PE=1 SV=1
8	Q8R0T6	1.00e-56	208	542	0.115	0.258	AGRG3_MOUSE Adhesion G protein-coupled receptor G3 OS=Mus musculus OX=10090 GN=Adgrg3 PE=2 SV=3
9	Q8IZF4	3.31e-52	194	528	0.110	0.254	AGRG5_HUMAN Adhesion G-protein coupled receptor G5 OS=Homo sapiens OX=9606 GN=ADGRG5 PE=1 SV=3
10	Q8K209	2.84e-51	195	687	0.117	0.208	AGRG1_MOUSE Adhesion G-protein coupled receptor G1 OS=Mus musculus OX=10090 GN=Adgrg1 PE=1 SV=1
11	Q9Y653	6.26e-50	191	693	0.106	0.188	AGRG1_HUMAN Adhesion G-protein coupled receptor G1 OS=Homo sapiens OX=9606 GN=ADGRG1 PE=1 SV=2
12	Q9HAR2	5.99e-48	190	1447	0.164	0.138	AGRL3_HUMAN Adhesion G protein-coupled receptor L3 OS=Homo sapiens OX=9606 GN=ADGRL3 PE=1 SV=2
13	O95490	4.80e-47	187	1459	0.156	0.130	AGRL2_HUMAN Adhesion G protein-coupled receptor L2 OS=Homo sapiens OX=9606 GN=ADGRL2 PE=1 SV=2
14	Q9Z173	1.04e-45	182	1550	0.136	0.107	AGRL3_RAT Adhesion G protein-coupled receptor L3 OS=Rattus norvegicus OX=10116 GN=Adgrl3 PE=1 SV=1
15	Q80TS3	1.18e-45	182	1537	0.148	0.118	AGRL3_MOUSE Adhesion G protein-coupled receptor L3 OS=Mus musculus OX=10090 GN=Adgrl3 PE=1 SV=3
16	O88917	2.32e-43	175	1515	0.156	0.125	AGRL1_RAT Adhesion G protein-coupled receptor L1 OS=Rattus norvegicus OX=10116 GN=Adgrl1 PE=1 SV=1
17	O88923	2.34e-43	175	1487	0.146	0.120	AGRL2_RAT Adhesion G protein-coupled receptor L2 OS=Rattus norvegicus OX=10116 GN=Adgrl2 PE=1 SV=2
18	Q96K78	2.87e-43	172	797	0.138	0.212	AGRG7_HUMAN Adhesion G-protein coupled receptor G7 OS=Homo sapiens OX=9606 GN=ADGRG7 PE=1 SV=2
19	Q80TR1	4.16e-43	174	1466	0.155	0.129	AGRL1_MOUSE Adhesion G protein-coupled receptor L1 OS=Mus musculus OX=10090 GN=Adgrl1 PE=1 SV=2
20	O94910	2.33e-42	172	1474	0.104	0.086	AGRL1_HUMAN Adhesion G protein-coupled receptor L1 OS=Homo sapiens OX=9606 GN=ADGRL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00002 7tm_2	1.6e-43	160.4	7 transmembrane receptor (Secretin family)
2	PF00431 CUB	4.4e-23	93.1	CUB domain
3	PF02408 CUB_2	50	15.1	CUB-like domain
4	PF01825 GPS	4e-10	51.5	GPCR proteolysis site, GPS, motif
5	PF00354 Pentaxin	1e-06	40.1	Pentaxin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000013099

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000018280	0.706	Prion protein
2	60711.ENSCSAP00000017857	0.637	POU domain protein
3	60711.ENSCSAP00000007491	0.622	Calcium-dependent lectin that mediates cell adhesion by binding to glycoproteins on neighboring cells. Mediates the adherence of lymphocytes to endothelial cells of high endothelial venules in peripheral lymph nodes. Promotes initial tethering and rolling of leukocytes in endothelia
4	60711.ENSCSAP00000000805	0.559	RasGEF domain family, member 1B
5	60711.ENSCSAP00000003860	0.558	N-acetylated alpha-linked acidic dipeptidase-like 1
6	60711.ENSCSAP00000009897	0.557	Dorsalizing factor. Key developmental protein that dorsalizes early vertebrate embryonic tissues by binding to ventralizing TGF-beta family bone morphogenetic proteins (BMPs) and sequestering them in latent complexes
7	60711.ENSCSAP00000000879	0.531	SET binding factor 2
8	60711.ENSCSAP00000014948	0.516	Uncharacterized protein
9	60711.ENSCSAP00000007275	0.513	CD93 molecule

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0008233	1.000	peptidase activity
GO:0004930	1.000	G protein-coupled receptor activity
GO:0004175	0.987	endopeptidase activity
GO:0005515	0.979	protein binding
GO:0050840	0.933	extracellular matrix binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0007186	0.985	G protein-coupled receptor signaling pathway
GO:0007275	0.965	multicellular organism development
GO:0048731	0.961	system development
GO:0048869	0.906	cellular developmental process
GO:0007272	0.888	ensheathment of neurons
GO:0022008	0.886	neurogenesis
GO:0008366	0.884	axon ensheathment
GO:0014037	0.815	Schwann cell differentiation
GO:0042552	0.776	myelination
GO:0019932	0.732	second-messenger-mediated signaling
GO:0019935	0.563	cyclic-nucleotide-mediated signaling
GO:0019933	0.418	cAMP-mediated signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005886	0.999	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0031090	0.946	organelle membrane
GO:0009986	0.795	cell surface
GO:0043233	0.416	organelle lumen
GO:0005783	0.364	endoplasmic reticulum
GO:0070013	0.344	intracellular organelle lumen
GO:0042175	0.329	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.325	endoplasmic reticulum subcompartment
GO:0005789	0.307	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]