StarFunc result for job id Q86SQ9

User Input

>input (333 residues)
MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAE
TLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRV
LGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDP
SDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNL
FEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLH
KLSARREERVQGFLQALELKRADWLARLGTASA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86SQ9	1.000	1.000	1.663E-59	333	1.000	1.000	Q86SQ9.pdb.gz	DHDDS_HUMAN Dehydrodolichyl diphosphate synthase complex subunit DHDDS OS=Homo sapiens OX=9606 GN=DHDDS PE=1 SV=3
2	PDB:7payA	0.964	0.976	5.722E-54	329	0.982	0.994	7payA.pdb.gz	Structural basis for long-chain isoprenoid synthesis by cis -prenyltransferases.
3	AFDB:F1R4X6	0.984	0.979	9.321E-48	335	0.694	0.690	F1R4X6.pdb.gz
4	AFDB:Q8S2T1	0.688	0.775	1.441E-24	295	0.312	0.353	Q8S2T1.pdb.gz	DDPS6_ARATH Dehydrodolichyl diphosphate synthase 6 OS=Arabidopsis thaliana OX=3702 GN=At2g17570 PE=2 SV=2
5	AFDB:O14171	0.681	0.853	3.265E-24	264	0.321	0.405	O14171.pdb.gz	YE54_SCHPO Dehydrodolichyl diphosphate synthase complex subunit SPAC4D7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4D7.04c PE=1 SV=2
6	AFDB:Q5AJZ3	0.666	0.676	5.052E-24	328	0.315	0.320	Q5AJZ3.pdb.gz	Q5AJZ3_CANAL Alkyl transferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RER2 PE=3 SV=1
7	AFDB:K7WCI9	0.706	0.807	8.715E-24	290	0.312	0.359	K7WCI9.pdb.gz	CPT3_SOLLC Dehydrodolichyl diphosphate synthase CPT3 OS=Solanum lycopersicum OX=4081 GN=CPT3 PE=1 SV=1
8	AFDB:Q8RX73	0.650	0.714	4.013E-23	302	0.270	0.298	Q8RX73.pdb.gz	DDPS3_ARATH Dehydrodolichyl diphosphate synthase 3 OS=Arabidopsis thaliana OX=3702 GN=At5g58780 PE=2 SV=1
9	AFDB:Q8TJQ7	0.696	0.775	4.727E-23	298	0.267	0.299	Q8TJQ7.pdb.gz	UPPS_METAC Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) OX=188937 GN=uppS PE=3 SV=1
10	AFDB:K4D3U9	0.639	0.689	5.567E-23	308	0.270	0.292	K4D3U9.pdb.gz	CPT4_SOLLC Cis-prenyltransferase 4, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CPT4 PE=2 SV=1
11	AFDB:Q47SS3	0.640	0.829	1.750E-22	254	0.237	0.311	Q47SS3.pdb.gz	ZFPP_THEFY (2Z,6E)-farnesyl diphosphate synthase OS=Thermobifida fusca (strain YX) OX=269800 GN=Tfu_0456 PE=1 SV=1
12	PDB:7cpmA	0.637	0.861	9.885E-22	244	0.243	0.332	7cpmA.pdb.gz
13	PDB:1x07A	0.643	0.917	8.759E-21	231	0.243	0.351	1x07A.pdb.gz	Crystal structures of undecaprenyl pyrophosphate synthase in complex with magnesium, isopentenyl pyrophosphate, and farnesyl thiopyrophosphate: roles of the metal ion and conserved residues in catalysis.
14	PDB:6imeA	0.638	0.740	1.089E-20	285	0.246	0.288	6imeA.pdb.gz	Substrate-analogue complex structure of Mycobacterium tuberculosis decaprenyl diphosphate synthase.
15	PDB:5kh4A	0.639	0.909	1.019E-19	231	0.255	0.368	5kh4A.pdb.gz	Discovery and Characterization of a Class of Pyrazole Inhibitors of Bacterial Undecaprenyl Pyrophosphate Synthase.
16	PDB:5zheA	0.567	0.905	1.697E-16	206	0.216	0.350	5zheA.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
17	PDB:3wqmA	0.554	0.619	4.402E-9	294	0.141	0.160	3wqmA.pdb.gz	Structure and inhibition of tuberculosinol synthase and decaprenyl diphosphate synthase from Mycobacterium tuberculosis.
18	PDB:6qkbA	0.186	0.171	5.933E-2	384	0.087	0.076	6qkbA.pdb.gz	Marine Proteobacteria metabolize glycolate via the beta-hydroxyaspartate cycle.
19	PDB:1oqfA	0.173	0.189	8.230E-2	290	0.114	0.131	1oqfA.pdb.gz
20	PDB:6y5rA	0.121	0.068	1.499E-1	879	0.099	0.038	6y5rA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86SQ9	0.0	690	333	1.000	1.000	DHDDS_HUMAN Dehydrodolichyl diphosphate synthase complex subunit DHDDS OS=Homo sapiens OX=9606 GN=DHDDS PE=1 SV=3
2	Q6NXA2	4.46e-170	478	335	0.694	0.690	Q6NXA2_DANRE Alkyl transferase OS=Danio rerio OX=7955 GN=zgc:77088 PE=1 SV=1
3	O14171	8.39e-69	218	264	0.318	0.402	YE54_SCHPO Dehydrodolichyl diphosphate synthase complex subunit SPAC4D7.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4D7.04c PE=1 SV=2
4	Q5AJZ3	5.09e-66	213	328	0.321	0.326	Q5AJZ3_CANAL Alkyl transferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RER2 PE=3 SV=1
5	B9W9M1	1.45e-59	195	314	0.336	0.357	B9W9M1_CANDC Alkyl transferase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) OX=573826 GN=SRT1 PE=3 SV=1
6	Q8S2T1	4.97e-58	191	295	0.324	0.366	DDPS6_ARATH Dehydrodolichyl diphosphate synthase 6 OS=Arabidopsis thaliana OX=3702 GN=At2g17570 PE=2 SV=2
7	K7WCI9	7.84e-57	187	290	0.333	0.383	CPT3_SOLLC Dehydrodolichyl diphosphate synthase CPT3 OS=Solanum lycopersicum OX=4081 GN=CPT3 PE=1 SV=1
8	P35196	4.06e-54	181	286	0.306	0.357	RER2_YEAST Dehydrodolichyl diphosphate synthase complex subunit RER2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RER2 PE=1 SV=1
9	Q8TJQ7	1.54e-50	171	298	0.285	0.319	UPPS_METAC Tritrans,polycis-undecaprenyl-diphosphate synthase (geranylgeranyl-diphosphate specific) OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) OX=188937 GN=uppS PE=3 SV=1
10	Q8RX73	4.67e-47	162	302	0.261	0.288	DDPS3_ARATH Dehydrodolichyl diphosphate synthase 3 OS=Arabidopsis thaliana OX=3702 GN=At5g58780 PE=2 SV=1
11	K4D3U9	5.57e-47	162	308	0.276	0.299	CPT4_SOLLC Cis-prenyltransferase 4, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CPT4 PE=2 SV=1
12	K7X479	1.24e-46	162	313	0.273	0.291	CPT5_SOLLC Dehydrodolichyl diphosphate synthase CPT5, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CPT5 PE=1 SV=1
13	O80458	1.29e-46	161	303	0.252	0.277	DDPS1_ARATH Dehydrodolichyl diphosphate synthase 1 OS=Arabidopsis thaliana OX=3702 GN=DPS PE=1 SV=2
14	Q56Y11	4.24e-45	158	310	0.261	0.281	DDPS2_ARATH Dehydrodolichyl diphosphate synthase 2 OS=Arabidopsis thaliana OX=3702 GN=At5g58770 PE=2 SV=2
15	C1K5M2	4.58e-45	157	303	0.276	0.304	CPT1_SOLLC Dimethylallylcistransferase CPT1, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CPT1 PE=1 SV=1
16	Q97SR4	1.91e-44	154	252	0.261	0.345	ISPT_STRPN Isoprenyl transferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=uppS PE=1 SV=1
17	K7WQ45	3.91e-44	155	314	0.273	0.290	CPT2_SOLLC Nerylneryl diphosphate synthase CPT2, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CPT2 PE=1 SV=1
18	Q03175	7.66e-41	147	343	0.285	0.277	SRT1_YEAST Dehydrodolichyl diphosphate synthase complex subunit SRT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRT1 PE=1 SV=1
19	Q47SS3	3.68e-39	140	254	0.255	0.335	ZFPP_THEFY (2Z,6E)-farnesyl diphosphate synthase OS=Thermobifida fusca (strain YX) OX=269800 GN=Tfu_0456 PE=1 SV=1
20	K7W9N9	8.59e-39	140	285	0.258	0.302	CPT6_SOLLC (2Z,6Z)-farnesyl diphosphate synthase CPT6, chloroplastic OS=Solanum lycopersicum OX=4081 GN=CPT6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14226 DIOX_N	3e+02	13.5	non-haem dioxygenase in morphine synthesis N-terminal
2	PF04337 DUF480	1.3e+02	14.1	Protein of unknown function, DUF480
3	PF01255 Prenyltransf	2.7e-74	261.0	Putative undecaprenyl diphosphate synthase
4	PF15490 Ten1_2	46	15.2	Telomere-capping, CST complex subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000011335

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016300	0.997	NUS1 dehydrodolichyl diphosphate synthase subunit
2	61853.ENSNLEP00000014716	0.993	Farnesyl diphosphate synthase
3	61853.ENSNLEP00000003419	0.964	Geranylgeranyl diphosphate synthase 1
4	61853.ENSNLEP00000017423	0.960	Essential subunit of the farnesyltransferase complex. Catalyzes the transfer of a farnesyl moiety from farnesyl diphosphate to a cysteine at the fourth position from the C-terminus of several proteins having the C-terminal sequence Cys-aliphatic-aliphatic-X.
5	61853.ENSNLEP00000020455	0.956	Prenyl (decaprenyl) diphosphate synthase, subunit 1
6	61853.ENSNLEP00000015746	0.951	Uncharacterized protein
7	61853.ENSNLEP00000016329	0.949	Prenyl (decaprenyl) diphosphate synthase, subunit 2
8	61853.ENSNLEP00000011010	0.904	4-hydroxybenzoate polyprenyltransferase, mitochondrial
9	61853.ENSNLEP00000018325	0.868	Farnesyl-diphosphate farnesyltransferase 1
10	61853.ENSNLEP00000021408	0.748	Dolichyldiphosphatase 1
11	61853.ENSNLEP00000019870	0.732	Isoprenoid synthase domain containing
12	61853.ENSNLEP00000008538	0.704	Dolichyl-phosphate mannosyltransferase polypeptide 1, catalytic subunit
13	61853.ENSNLEP00000016458	0.699	Isopentenyl-diphosphate delta isomerase 1
14	61853.ENSNLEP00000010319	0.698	Steroid 5 alpha-reductase 3
15	61853.ENSNLEP00000022859	0.651	Dolichol kinase
16	61853.ENSNLEP00000011687	0.650	Uncharacterized protein
17	61853.ENSNLEP00000011753	0.646	mannose-P-dolichol utilization defect 1
18	61853.ENSNLEP00000020709	0.646	ALG2, alpha-1,3/1,6-mannosyltransferase
19	61853.ENSNLEP00000008876	0.633	annotation not available
20	61853.ENSNLEP00000002075	0.620	ALG5, dolichyl-phosphate beta-glucosyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004659	1.000	prenyltransferase activity
GO:0005515	0.999	protein binding
GO:0045547	0.724	dehydrodolichyl diphosphate synthase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.986	organic substance metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0044238	0.985	primary metabolic process
GO:0008610	0.970	lipid biosynthetic process
GO:1901137	0.932	carbohydrate derivative biosynthetic process
GO:0034645	0.929	cellular macromolecule biosynthetic process
GO:0006807	0.906	nitrogen compound metabolic process
GO:0006486	0.900	protein glycosylation
GO:0006487	0.864	protein N-linked glycosylation
GO:0044255	0.863	cellular lipid metabolic process
GO:0090407	0.863	organophosphate biosynthetic process
GO:0006490	0.813	oligosaccharide-lipid intermediate biosynthetic process
GO:0008654	0.808	phospholipid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.995	endomembrane system
GO:0032991	0.994	protein-containing complex
GO:0005783	0.969	endoplasmic reticulum
GO:0005789	0.962	endoplasmic reticulum membrane
GO:1902494	0.953	catalytic complex
GO:1990234	0.885	transferase complex
GO:0070013	0.487	intracellular organelle lumen
GO:0005634	0.465	nucleus
GO:0005829	0.426	cytosol
GO:0031981	0.303	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.5.1.-	1.000	Transferring alkyl or aryl groups, other than methyl groups.

[back to server]