StarFunc result for job id Q86T03

User Input

>input (277 residues)
MAADGERSPLLSEPIDGGAGGNGLVGPGGSGAGPGGGLTPSAPPYGAAFPPFPEGHPAVL
PGEDPPPYSPLTSPDSGSAPMITCRVCQSLINVEGKMHQHVVKCGVCNEATPIKNAPPGK
KYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVICGHCKNT
FLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGTWKHARRY
GGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3TWL2	0.481	0.471	8.769E-47	284	0.971	0.947	Q3TWL2.pdb.gz	PP4P1_MOUSE Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase OS=Mus musculus OX=10090 GN=Pip4p1 PE=1 SV=1
2	AFDB:Q8N4L2	0.418	0.449	3.409E-30	257	0.531	0.572	Q8N4L2.pdb.gz	PP4P2_HUMAN Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase OS=Homo sapiens OX=9606 GN=PIP4P2 PE=1 SV=1
3	PDB:5n5yI	0.118	0.289	2.302E-1	99	0.069	0.192	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
4	PDB:4c2mI	0.118	0.239	5.043E-1	124	0.076	0.169	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
5	PDB:4kblA	0.075	0.058	6.420E-1	395	0.137	0.096	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
6	PDB:7oqyY	0.112	0.295	1.105	92	0.072	0.217	7oqyY.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
7	AFDB:Q7Z698	0.130	0.100	1.405	418	0.170	0.112	Q7Z698.pdb.gz	SPRE2_HUMAN Sprouty-related, EVH1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SPRED2 PE=1 SV=2
8	AFDB:A0A5F9ZH18	0.103	0.031	1.684	1109	0.094	0.023	A0A5F9ZH18.pdb.gz	A0A5F9ZH18_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
9	AFDB:A1Z8R2	0.141	0.051	1.684	1199	0.144	0.033	A1Z8R2.pdb.gz	A1Z8R2_DROME ADD domain-containing protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ADD1 PE=1 SV=1
10	AFDB:Q54DM3	0.141	0.039	1.789	1259	0.119	0.026	Q54DM3.pdb.gz	Q54DM3_DICDI DNA helicase OS=Dictyostelium discoideum OX=44689 GN=blm PE=3 SV=1
11	AFDB:Q96K62	0.097	0.058	2.144	511	0.108	0.059	Q96K62.pdb.gz	ZBT45_HUMAN Zinc finger and BTB domain-containing protein 45 OS=Homo sapiens OX=9606 GN=ZBTB45 PE=1 SV=1
12	PDB:4ohfB	0.140	0.095	2.146	458	0.022	0.013	4ohfB.pdb.gz	Allosteric regulation and substrate activation in cytosolic nucleotidase II from Legionella pneumophila.
13	PDB:6hlqI	0.107	0.243	2.280	111	0.047	0.117	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
14	AFDB:F4JP43	0.195	0.031	2.419	2037	0.152	0.021	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1
15	PDB:6c6lO	0.133	0.324	2.422	76	0.051	0.184	6c6lO.pdb.gz
16	PDB:3zk1A	0.168	0.426	3.478	89	0.032	0.101	3zk1A.pdb.gz	A New Type of Na(+)-Driven ATP Synthase Membrane Rotor with a Two-Carboxylate Ion-Coupling Motif.
17	AFDB:Q5T7B8	0.190	0.045	3.920	1368	0.191	0.039	Q5T7B8.pdb.gz	KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens OX=9606 GN=KIF24 PE=1 SV=2
18	AFDB:Q9VJ27	0.077	0.034	3.920	762	0.141	0.051	Q9VJ27.pdb.gz	Q9VJ27_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10431 PE=4 SV=3
19	PDB:7rr9A	0.187	0.095	3.925	560	0.036	0.018	7rr9A.pdb.gz	Structures of the human peroxisomal fatty acid transporter ABCD1 in a lipid environment
20	PDB:8eaue	0.130	0.314	3.925	72	0.040	0.153	8eaue.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TWL2	0.0	536	284	0.971	0.947	PP4P1_MOUSE Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase OS=Mus musculus OX=10090 GN=Pip4p1 PE=1 SV=1
2	Q86T03	0.0	559	277	1.000	1.000	PP4P1_HUMAN Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase OS=Homo sapiens OX=9606 GN=PIP4P1 PE=1 SV=1
3	Q8N4L2	6.50e-93	276	257	0.534	0.576	PP4P2_HUMAN Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase OS=Homo sapiens OX=9606 GN=PIP4P2 PE=1 SV=1
4	Q9CZX7	3.13e-91	272	257	0.527	0.568	PP4P2_MOUSE Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase OS=Mus musculus OX=10090 GN=Pip4p2 PE=1 SV=1
5	Q9NQT8	0.063	37.4	1826	0.112	0.017	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2
6	F4KDH9	0.16	35.8	1196	0.094	0.022	FIPS5_ARATH FIP1[V]-like protein OS=Arabidopsis thaliana OX=3702 GN=FIPS5 PE=1 SV=1
7	A0A0G2K9D6	0.47	34.3	1083	0.058	0.015	A0A0G2K9D6_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
8	A0A8I5ZP90	0.47	34.3	1045	0.058	0.015	A0A8I5ZP90_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
9	D3ZJU5	0.47	34.3	1078	0.058	0.015	D3ZJU5_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
10	A0A8I6AMA8	0.49	34.3	1102	0.058	0.015	A0A8I6AMA8_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=4 SV=1
11	R4GMQ1	0.90	33.5	858	0.076	0.024	R4GMQ1_HUMAN Lysine-specific histone demethylase OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2
12	O60341	0.91	33.5	852	0.076	0.025	KDM1A_HUMAN Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2
13	O94887	1.0	33.5	1054	0.076	0.020	FARP2_HUMAN FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2 PE=1 SV=3
14	P94077	1.2	32.3	189	0.043	0.063	LSD1_ARATH Protein LSD1 OS=Arabidopsis thaliana OX=3702 GN=LSD1 PE=1 SV=1
15	Q9VHK1	2.1	32.3	1735	0.083	0.013	Q9VHK1_DROME Polychaetoid, isoform J OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=4
16	O60244	2.2	32.3	1454	0.097	0.019	MED14_HUMAN Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens OX=9606 GN=MED14 PE=1 SV=2
17	A8JQV7	2.3	32.3	1301	0.083	0.018	A8JQV7_DROME Polychaetoid, isoform G OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
18	B7Z0U1	2.5	32.3	1386	0.083	0.017	B7Z0U1_DROME Polychaetoid, isoform I OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
19	Q8INQ0	2.5	32.3	1293	0.083	0.018	Q8INQ0_DROME Polychaetoid, isoform C OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=2
20	Q94880	2.5	32.3	1367	0.083	0.017	Q94880_DROME TamA OS=Drosophila melanogaster OX=7227 GN=pyd PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06072 Herpes_US9	6e+02	11.7	Alphaherpesvirus tegument protein US9
2	PF09788 Tmemb_55A	1.6e-124	425.6	Transmembrane protein 55A
3	PF11331 zinc_ribbon_12	8.2	17.6	Probable zinc-ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9668.ENSMPUP00000018009

Rank	PPI partner	STRING score	Description
1	9668.ENSMPUP00000011986	0.961	Phosphatidylinositol-5-phosphate 4-kinase, type II, alpha
2	9668.ENSMPUP00000001835	0.958	Phosphatidylinositol-5-phosphate 4-kinase, type II, gamma
3	9668.ENSMPUP00000011397	0.882	Inositol polyphosphate-5-phosphatase, 72 kDa
4	9668.ENSMPUP00000014968	0.871	Phosphatidylinositol-5-phosphate 4-kinase, type II, beta
5	9668.ENSMPUP00000000514	0.857	Phosphoinositide kinase, FYVE finger containing
6	9668.ENSMPUP00000010919	0.857	Endothelial differentiation-related factor 1
7	9668.ENSMPUP00000001142	0.856	Synaptojanin 1
8	9668.ENSMPUP00000017314	0.856	OCRL, inositol polyphosphate-5-phosphatase
9	9668.ENSMPUP00000011494	0.852	Myotubularin 1
10	9668.ENSMPUP00000005285	0.850	Synaptojanin 2
11	9668.ENSMPUP00000014419	0.850	Inositol polyphosphate-5-phosphatase, 75kDa
12	9668.ENSMPUP00000000646	0.849	Myotubularin related protein 6
13	9668.ENSMPUP00000009132	0.848	Catalyzes the hydrolysis of phosphatidylinositol-4,5- bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P)
14	9668.ENSMPUP00000011501	0.846	Myotubularin related protein 1
15	9668.ENSMPUP00000012194	0.846	Myotubularin related protein 2
16	9668.ENSMPUP00000013131	0.846	Myotubularin related protein 3
17	9668.ENSMPUP00000015207	0.846	Myotubularin related protein 4
18	9668.ENSMPUP00000003857	0.845	Phosphatidylinositol-4-phosphate 5-kinase, type I, alpha
19	9668.ENSMPUP00000004016	0.845	Phosphatidylinositol-4-phosphate 5-kinase, type I, gamma
20	9668.ENSMPUP00000006192	0.845	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.973	catalytic activity
GO:0016788	0.945	hydrolase activity, acting on ester bonds
GO:0042578	0.761	phosphoric ester hydrolase activity
GO:0016791	0.708	phosphatase activity
GO:0052866	0.605	phosphatidylinositol phosphate phosphatase activity
GO:0034593	0.586	phosphatidylinositol bisphosphate phosphatase activity
GO:0106019	0.569	phosphatidylinositol-4,5-bisphosphate phosphatase activity
GO:0034596	0.547	phosphatidylinositol phosphate 4-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.997	positive regulation of cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:1903432	0.993	regulation of TORC1 signaling
GO:0046488	0.986	phosphatidylinositol metabolic process
GO:0009967	0.979	positive regulation of signal transduction
GO:1904263	0.928	positive regulation of TORC1 signaling
GO:0051179	0.793	localization
GO:0016311	0.777	dephosphorylation
GO:0030258	0.760	lipid modification
GO:1901615	0.669	organic hydroxy compound metabolic process
GO:0046856	0.666	phosphatidylinositol dephosphorylation
GO:1990849	0.595	vacuolar localization
GO:0050896	0.534	response to stimulus
GO:1901796	0.513	regulation of signal transduction by p53 class mediator
GO:0044281	0.383	small molecule metabolic process
GO:0009058	0.360	biosynthetic process
GO:0090407	0.349	organophosphate biosynthetic process
GO:0008610	0.347	lipid biosynthetic process
GO:0044249	0.343	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031902	1.000	late endosome membrane
GO:0005765	0.998	lysosomal membrane
GO:0005886	0.930	plasma membrane
GO:0031981	0.840	nuclear lumen
GO:0005654	0.805	nucleoplasm
GO:0032991	0.542	protein-containing complex
GO:0030139	0.384	endocytic vesicle
GO:0045335	0.313	phagocytic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.945	Acting on ester bonds.
EC:3.1.3.-	0.708	Phosphoric monoester hydrolases.

[back to server]