StarFunc result for job id Q86T20

User Input

>input (102 residues)
MSNTTVPNAPQANSDSMVGYVLGPFFLITLVGVVVAVVMYVQKKKRVDRLRHHLLPMYSY
DPAEELHEAEQELLSDMGDPKVVHGWQSGYQHKRMPLLDVKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q28820	0.248	0.052	1.304	706	0.245	0.035	Q28820.pdb.gz	TRDN_RABIT Triadin OS=Oryctolagus cuniculus OX=9986 GN=TRDN PE=1 SV=3
2	AFDB:P15083	0.385	0.068	1.408	769	0.206	0.027	P15083.pdb.gz	PIGR_RAT Polymeric immunoglobulin receptor OS=Rattus norvegicus OX=10116 GN=Pigr PE=1 SV=1
3	AFDB:P97463	0.308	0.165	1.774	195	0.127	0.067	P97463.pdb.gz	NRTN_MOUSE Neurturin OS=Mus musculus OX=10090 GN=Nrtn PE=1 SV=1
4	AFDB:Q9Y4I9	0.331	0.046	1.774	986	0.225	0.023	Q9Y4I9.pdb.gz	Q9Y4I9_HUMAN Tyrosine phosphatase IA-2beta OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:O08843	0.387	0.410	2.606	95	0.167	0.179	O08843.pdb.gz	LST1_MOUSE Leukocyte-specific transcript 1 protein OS=Mus musculus OX=10090 GN=Lst1 PE=1 SV=1
6	AFDB:P01832	0.304	0.050	2.606	773	0.147	0.019	P01832.pdb.gz	PIGR_RABIT Polymeric immunoglobulin receptor OS=Oryctolagus cuniculus OX=9986 GN=PIGR PE=1 SV=1
7	AFDB:Q9VLD6	0.338	0.142	2.814	315	0.167	0.054	Q9VLD6.pdb.gz	BOREA_DROME Borealin OS=Drosophila melanogaster OX=7227 GN=borr PE=1 SV=1
8	AFDB:Q9H147	0.238	0.094	3.039	329	0.176	0.055	Q9H147.pdb.gz	TDIF1_HUMAN Deoxynucleotidyltransferase terminal-interacting protein 1 OS=Homo sapiens OX=9606 GN=DNTTIP1 PE=1 SV=2
9	PDB:6hivDH	0.157	0.036	3.182	564	0.108	0.020	6hivDH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
10	AFDB:G5EF76	0.183	0.111	3.282	173	0.127	0.075	G5EF76.pdb.gz	LIN22_CAEEL Helix-loop-helix protein lin-22 OS=Caenorhabditis elegans OX=6239 GN=lin-22 PE=1 SV=1
11	AFDB:P47081	0.268	0.241	3.544	118	0.118	0.102	P47081.pdb.gz	COX16_YEAST Cytochrome c oxidase assembly protein COX16, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX16 PE=1 SV=1
12	PDB:2dyrI	0.204	0.260	9.339	73	0.078	0.110	2dyrI.pdb.gz	Structures and physiological roles of 13 integral lipids of bovine heart cytochrome c oxidase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9SYX1	0.025	34.7	262	0.186	0.073	LIL31_ARATH Light-harvesting complex-like protein 3 isotype 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LIL3.1 PE=1 SV=1
2	Q6NKS4	0.18	32.3	258	0.176	0.070	LIL32_ARATH Light-harvesting complex-like protein 3 isotype 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LIL3.2 PE=1 SV=1
3	C0LGH3	0.20	32.3	1033	0.127	0.013	Y5614_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56140 OS=Arabidopsis thaliana OX=3702 GN=At1g56140 PE=2 SV=2
4	P47735	0.20	32.3	999	0.225	0.023	RLK5_ARATH Receptor-like protein kinase 5 OS=Arabidopsis thaliana OX=3702 GN=RLK5 PE=1 SV=1
5	Q9ZUE0	1.1	30.4	720	0.265	0.037	PEK12_ARATH Proline-rich receptor-like protein kinase PERK12 OS=Arabidopsis thaliana OX=3702 GN=PERK12 PE=2 SV=2
6	A0A0B4K7J3	1.3	30.0	582	0.147	0.026	A0A0B4K7J3_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=3 SV=1
7	Q7JPM7	1.3	30.0	570	0.147	0.026	Q7JPM7_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
8	Q7JPN8	1.3	30.0	570	0.147	0.026	Q7JPN8_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
9	Q7JQ36	1.3	30.0	570	0.147	0.026	Q7JQ36_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
10	Q7JQ39	1.3	30.0	570	0.147	0.026	Q7JQ39_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
11	Q95U21	1.3	30.0	535	0.147	0.028	Q95U21_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=sax PE=2 SV=1
12	M9NDQ0	1.5	30.0	3200	0.127	0.004	M9NDQ0_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform E OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
13	A8JUY8	1.6	30.0	3205	0.127	0.004	A8JUY8_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform C OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
14	M9NGR9	1.6	30.0	3180	0.127	0.004	M9NGR9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform D OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
15	M9PGH9	1.6	30.0	3218	0.127	0.004	M9PGH9_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform F OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=1
16	Q9W433	1.6	30.0	3188	0.127	0.004	Q9W433_DROME Ca[2+]-channel protein alpha[[1]] subunit T, isoform B OS=Drosophila melanogaster OX=7227 GN=Ca-alpha1T PE=4 SV=3
17	C0LGH2	1.9	29.6	1032	0.118	0.012	Y1561_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g56130 OS=Arabidopsis thaliana OX=3702 GN=At1g56130 PE=2 SV=2
18	Q8IJ08	2.2	29.3	309	0.127	0.042	Q8IJ08_PLAF7 Rifin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1040100 PE=4 SV=1
19	Q2HIQ5	2.5	28.1	77	0.137	0.182	Q2HIQ5_ARATH At4g23885 OS=Arabidopsis thaliana OX=3702 GN=At4g23885 PE=1 SV=1
20	Q6P4T1	5.0	28.5	997	0.176	0.018	SNX19_MOUSE Sorting nexin-19 OS=Mus musculus OX=10090 GN=Snx19 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10177 DUF2371	4.7e+02	12.4	Uncharacterised conserved protein (DUF2371)
2	PF11667 DUF3267	2.8e+02	13.2	Putative zincin peptidase
3	PF16935 Hol_Tox	7.3e+02	11.5	Putative Holin-like Toxin (Hol-Tox)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 7955.ENSDARP00000100191

Rank	PPI partner	STRING score	Description
1	7955.ENSDARP00000129550	0.618	Cytosolic Fe-S cluster assembly factor nubp1
2	7955.ENSDARP00000110919	0.617	C-type lectin domain family 16, member A
3	7955.ENSDARP00000122475	0.606	Aminopeptidase puromycin sensitive
4	7955.ENSDARP00000047734	0.580	EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase
5	7955.ENSDARP00000075216	0.556	TATA element modulatory factor 1
6	7955.ENSDARP00000058106	0.551	Multiple coagulation factor deficiency 2
7	7955.ENSDARP00000099007	0.546	Tetratricopeptide repeat domain 7A
8	7955.ENSDARP00000038654	0.543	CASP2 and RIPK1 domain containing adaptor with death domain
9	7955.ENSDARP00000011930	0.526	WAS/WASL interacting protein family, member 2b
10	7955.ENSDARP00000075985	0.526	WAS/WASL interacting protein family, member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.902	cellular process
GO:0051179	0.690	localization
GO:0065007	0.467	biological regulation
GO:0050789	0.388	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0043226	0.981	organelle
GO:0016020	0.973	membrane
GO:0005737	0.957	cytoplasm
GO:0043231	0.926	intracellular membrane-bounded organelle
GO:0005886	0.700	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]