StarFunc result for job id Q86T24

User Input

>input (672 residues)
MESRKLISATDIQYSGSLLNSLNEQRGHGLFCDVTVIVEDRKFRAHKNILSASSTYFHQL
FSVAGQVVELSFIRAEIFAEILNYIYSSKIVRVRSDLLDELIKSGQLLGVKFIAELGVPL
SQVKSISGTAQDGNTEPLPPDSGDKNLVIQKSKDEAQDNGATIMPIITESFSLSAEDYEM
KKIIVTDSDDDDDDVIFCSEILPTKETLPSNNTVAQVQSNPGPVAISDVAPSASNNSPPL
TNITPTQKLPTPVNQATLSQTQGSEKLLVSSAPTHLTPNIILLNQTPLSTPPNVSSSLPN
HMPSSINLLVQNQQTPNSAILTGNKANEEEEEEIIDDDDDTISSSPDSAVSNTSLVPQAD
TSQNTSFDGSLIQKMQIPTLLQEPLSNSLKISDIITRNTNDPGVGSKHLMEGQKIITLDT
ATEIEGLSTGCKVYANIGEDTYDIVIPVKDDPDEGEARLENEIPKTSGSEMANKRMKVKH
DDHYELIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCRYCEKVFPLAEYRTKH
EIHHTGERRYQCLACGKSFINYQFMSSHIKSVHSQDPSGDSKLYRLHPCRSLQIRQYAYL
SDRSSTIPAMKDDGIGYKVDTGKEPPVGTTTSTQNKPMTWEDIFIQQENDSIFKQNVTDG
STEFEFIIPESY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86T24	0.999	0.999	0.000	672	1.000	1.000	Q86T24.pdb.gz	KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sapiens OX=9606 GN=ZBTB33 PE=1 SV=2
2	AFDB:Q8BN78	0.399	0.400	5.029E-90	671	0.881	0.882	Q8BN78.pdb.gz	KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus musculus OX=10090 GN=Zbtb33 PE=1 SV=1
3	AFDB:Q8UVQ4	0.379	0.368	3.611E-64	701	0.557	0.534	Q8UVQ4.pdb.gz	KAISO_XENLA Transcriptional regulator Kaiso OS=Xenopus laevis OX=8355 GN=zbtb33 PE=1 SV=2
4	AFDB:O15209	0.148	0.157	1.649E-17	634	0.176	0.186	O15209.pdb.gz	ZBT22_HUMAN Zinc finger and BTB domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZBTB22 PE=1 SV=1
5	AFDB:Q9ULJ3	0.153	0.097	2.250E-16	1066	0.213	0.134	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
6	AFDB:Q96K62	0.155	0.201	8.301E-15	511	0.143	0.188	Q96K62.pdb.gz	ZBT45_HUMAN Zinc finger and BTB domain-containing protein 45 OS=Homo sapiens OX=9606 GN=ZBTB45 PE=1 SV=1
7	AFDB:F1RAC1	0.140	0.085	1.983E-14	1146	0.159	0.093	F1RAC1.pdb.gz	F1RAC1_DANRE Zinc finger and BTB domain-containing 11 OS=Danio rerio OX=7955 GN=ZNF-U69274 PE=4 SV=1
8	AFDB:Q9V5M3	0.174	0.138	5.706E-13	878	0.196	0.150	Q9V5M3.pdb.gz	LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster OX=7227 GN=lola PE=1 SV=3
9	AFDB:Q24206	0.169	0.131	8.820E-13	880	0.190	0.145	Q24206.pdb.gz	BRC4_DROME Broad-complex core protein isoform 6 OS=Drosophila melanogaster OX=7227 GN=br PE=1 SV=2
10	AFDB:P42282	0.167	0.139	3.257E-12	813	0.195	0.161	P42282.pdb.gz	TTKA_DROME Protein tramtrack, alpha isoform OS=Drosophila melanogaster OX=7227 GN=ttk PE=1 SV=3
11	PDB:6wcqC	0.143	0.696	2.590E-7	130	0.036	0.185	6wcqC.pdb.gz
12	PDB:7mk2A	0.140	0.258	2.282E-4	354	0.033	0.062	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
13	PDB:2p1nD	0.105	0.518	1.149E-2	127	0.022	0.118	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
14	PDB:6r7fQ	0.108	0.562	1.301E-2	112	0.028	0.170	6r7fQ.pdb.gz
15	PDB:7w6sB	0.105	0.154	1.474E-2	448	0.018	0.027	7w6sB.pdb.gz
16	PDB:3ogkA	0.112	0.485	2.012E-2	145	0.022	0.103	3ogkA.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
17	PDB:6sgaFS	0.118	0.267	2.141E-2	277	0.027	0.065	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
18	PDB:5vztA	0.110	0.478	3.747E-2	145	0.021	0.097	5vztA.pdb.gz	Structural basis of the phosphorylation-independent recognition of cyclin D1 by the SCFFBXO31 ubiquitin ligase.
19	PDB:3w5kB	0.063	0.221	4.244E-2	110	0.025	0.155	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
20	PDB:7f3fA	0.104	0.149	6.164E-2	460	0.019	0.028	7f3fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86T24	0.0	1385	672	1.000	1.000	KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sapiens OX=9606 GN=ZBTB33 PE=1 SV=2
2	Q8BN78	0.0	1152	671	0.868	0.869	KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus musculus OX=10090 GN=Zbtb33 PE=1 SV=1
3	Q8UVQ4	0.0	685	701	0.582	0.558	KAISO_XENLA Transcriptional regulator Kaiso OS=Xenopus laevis OX=8355 GN=zbtb33 PE=1 SV=2
4	D6RBC4	2.85e-36	147	771	0.158	0.137	D6RBC4_HUMAN Zinc finger and BTB domain containing 38 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=1
5	A0A1B0GV48	2.90e-36	147	725	0.158	0.146	A0A1B0GV48_HUMAN Zinc finger and BTB domain containing 38 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=1
6	A0A0R4INF0	9.95e-36	147	1570	0.101	0.043	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
7	Q8NAP3	1.71e-35	146	1195	0.164	0.092	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
8	Q5EXX3	1.88e-34	143	1203	0.112	0.062	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
9	Q9P1Z0	1.81e-33	140	1013	0.094	0.062	ZBTB4_HUMAN Zinc finger and BTB domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZBTB4 PE=1 SV=3
10	J3QL74	1.26e-25	105	165	0.073	0.297	J3QL74_HUMAN Zinc finger and BTB domain containing 14 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=1
11	J3QLI2	1.89e-25	107	221	0.077	0.235	J3QLI2_HUMAN Zinc finger and BTB domain containing 14 (Fragment) OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=1
12	O43829	6.61e-24	107	449	0.077	0.116	ZBT14_HUMAN Zinc finger and BTB domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZBTB14 PE=1 SV=2
13	F1LMU5	8.94e-24	107	449	0.077	0.116	F1LMU5_RAT Zinc finger protein 161 OS=Rattus norvegicus OX=10116 GN=Zfp161 PE=1 SV=2
14	Q08376	8.94e-24	107	449	0.077	0.116	ZBT14_MOUSE Zinc finger and BTB domain-containing protein 14 OS=Mus musculus OX=10090 GN=Zbtb14 PE=2 SV=1
15	Q8CGQ6	9.28e-24	107	449	0.077	0.116	Q8CGQ6_RAT Zinc finger protein 161 OS=Rattus norvegicus OX=10116 GN=Zfp161 PE=2 SV=1
16	Q9ULJ3	9.44e-17	87.0	1066	0.083	0.053	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
17	Q7TSZ8	1.96e-13	75.5	514	0.061	0.080	NACC1_MOUSE Nucleus accumbens-associated protein 1 OS=Mus musculus OX=10090 GN=Nacc1 PE=1 SV=1
18	O35260	2.05e-13	75.5	514	0.061	0.080	NACC1_RAT Nucleus accumbens-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Nacc1 PE=1 SV=1
19	Q8VCZ7	3.36e-13	75.1	619	0.060	0.065	ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus OX=10090 GN=Zbtb7c PE=2 SV=1
20	Q13105	7.28e-13	74.3	803	0.067	0.056	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	1.3e-16	72.2	BTB/POZ domain
2	PF00096 zf-C2H2	1.1e+02	14.7	Zinc finger, C2H2 type
3	PF18868 zf-C2H2_3rep	94	15.2	Zinc finger C2H2-type, 3 repeats
4	PF13894 zf-C2H2_4	0.0088	27.8	C2H2-type zinc finger
5	PF13465 zf-H2C2_2	0.012	27.3	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314153

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382004	0.999	Catenin delta-1
2	9606.ENSP00000268712	0.988	Nuclear receptor corepressor 1
3	9606.ENSP00000261769	0.974	Cadherin-1
4	9606.ENSP00000307134	0.909	Catenin delta-2
5	9606.ENSP00000269305	0.835	Cellular tumor antigen p53
6	9606.ENSP00000358404	0.803	Transcription factor 7-like 2
7	9606.ENSP00000264010	0.799	Transcriptional repressor CTCF
8	9606.ENSP00000298854	0.767	43 kDa receptor-associated protein of the synapse
9	9606.ENSP00000262366	0.740	Zinc finger protein GLIS2
10	9606.ENSP00000249910	0.723	Methyl-CpG-binding domain protein 4
11	9606.ENSP00000362649	0.721	Histone deacetylase 1
12	9606.ENSP00000263207	0.716	Armadillo repeat protein deleted in velo-cardio-facial syndrome
13	9606.ENSP00000395535	0.699	Methyl-CpG-binding protein 2
14	9606.ENSP00000370936	0.698	Transcription factor E2F6
15	9606.ENSP00000344456	0.676	Catenin beta-1
16	9606.ENSP00000384018	0.675	Nuclear receptor corepressor 2
17	9606.ENSP00000260227	0.664	Matrilysin
18	9606.ENSP00000374409	0.610	Plakophilin-4
19	9606.ENSP00000365830	0.607	Ankyrin repeat domain-containing protein SOWAHC
20	9606.ENSP00000371219	0.607	Rho-related GTP-binding protein RhoH

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.999	sequence-specific DNA binding
GO:1990837	0.990	sequence-specific double-stranded DNA binding
GO:1901265	0.988	nucleoside phosphate binding
GO:0036094	0.987	small molecule binding
GO:0008327	0.958	methyl-CpG binding
GO:0000976	0.774	transcription cis-regulatory region binding
GO:0140110	0.542	transcription regulator activity
GO:0003700	0.478	DNA-binding transcription factor activity
GO:0000978	0.420	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.996	regulation of DNA-templated transcription
GO:0009987	0.989	cellular process
GO:0048523	0.987	negative regulation of cellular process
GO:0051253	0.935	negative regulation of RNA metabolic process
GO:0045892	0.934	negative regulation of DNA-templated transcription
GO:0050896	0.863	response to stimulus
GO:0051716	0.823	cellular response to stimulus
GO:0023052	0.783	signaling
GO:0007154	0.761	cell communication
GO:0007165	0.728	signal transduction
GO:0006357	0.543	regulation of transcription by RNA polymerase II
GO:0035556	0.498	intracellular signal transduction
GO:0048518	0.483	positive regulation of biological process
GO:0048522	0.367	positive regulation of cellular process
GO:0009893	0.332	positive regulation of metabolic process
GO:0010604	0.309	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0043228	0.889	non-membrane-bounded organelle
GO:0043232	0.879	intracellular non-membrane-bounded organelle
GO:0005737	0.858	cytoplasm
GO:0005829	0.848	cytosol
GO:0016020	0.718	membrane
GO:0071944	0.668	cell periphery
GO:0005886	0.565	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]