StarFunc result for job id Q86T65

User Input

>input (1068 residues)
MAPRKRSHHGLGFLCCFGGSDIPEINLRDNHPLQFMEFSSPIPNAEELNIRFAELVDELD
LTDKNREAMFALPPEKKWQIYCSKKKEQEDPNKLATSWPDYYIDRINSMAAMQSLYAFDE
EETEMRNQVVEDLKTALRTQPMRFVTRFIELEGLTCLLNFLRSMDHATCESRIHTSLIGC
IKALMNNSQGRAHVLAQPEAISTIAQSLRTENSKTKVAVLEILGAVCLVPGGHKKVLQAM
LHYQVYAAERTRFQTLLNELDRSLGRYRDEVNLKTAIMSFINAVLNAGAGEDNLEFRLHL
RYEFLMLGIQPVIDKLRQHENAILDKHLDFFEMVRNEDDLELARRFDMVHIDTKSASQMF
ELIHKKLKYTEAYPCLLSVLHHCLQMPYKRNGGYFQQWQLLDRILQQIVLQDERGVDPDL
APLENFNVKNIVNMLINENEVKQWRDQAEKFRKEHMELVSRLERKERECETKTLEKEEMM
RTLNKMKDKLARESQELRQARGQVAELVAQLSELSTGPVSSPPPPGGPLTLSSSMTTNDL
PPPPPPLPFACCPPPPPPPLPPGGPPTPPGAPPCLGMGLPLPQDPYPSSDVPLRKKRVPQ
PSHPLKSFNWVKLNEERVPGTVWNEIDDMQVFRILDLEDFEKMFSAYQRHQKELGSTEDI
YLASRKVKELSVIDGRRAQNCIILLSKLKLSNEEIRQAILKMDEQEDLAKDMLEQLLKFI
PEKSDIDLLEEHKHEIERMARADRFLYEMSRIDHYQQRLQALFFKKKFQERLAEAKPKVE
AILLASRELVRSKRLRQMLEVILAIGNFMNKGQRGGAYGFRVASLNKIADTKSSIDRNIS
LLHYLIMILEKHFPDILNMPSELQHLPEAAKVNLAELEKEVGNLRRGLRAVEVELEYQRR
QVREPSDKFVPVMSDFITVSSFSFSELEDQLNEARDKFAKALMHFGEHDSKMQPDEFFGI
FDTFLQAFSEARQDLEAMRRRKEEEERRARMEAMLKEQRERERWQRQRKVLAAGSSLEEG
GEFDDLVSALRSGEVFDKDLCKLKRSRKRSGSQALEVTRERAINRLNY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1D5P556	0.645	0.642	0.000	1075	0.821	0.816	A0A1D5P556.pdb.gz	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
2	AFDB:Q80U19	0.467	0.449	0.000	1115	0.919	0.880	Q80U19.pdb.gz	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
3	AFDB:Q86T65	1.000	1.000	0.000	1068	1.000	1.000	Q86T65.pdb.gz	DAAM2_HUMAN Disheveled-associated activator of morphogenesis 2 OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=3
4	AFDB:Q9Y4D1	0.473	0.469	1.071E-101	1078	0.690	0.684	Q9Y4D1.pdb.gz	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
5	AFDB:A0A0R4IER9	0.446	0.449	8.071E-101	1060	0.681	0.686	A0A0R4IER9.pdb.gz	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
6	AFDB:Q5RHJ3	0.619	0.614	3.391E-99	1079	0.674	0.667	Q5RHJ3.pdb.gz	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
7	AFDB:Q9W5A4	0.373	0.405	3.288E-64	979	0.421	0.460	Q9W5A4.pdb.gz	Q9W5A4_DROME EG:114D9.2 protein OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=2
8	AFDB:O60610	0.355	0.303	5.178E-43	1272	0.276	0.232	O60610.pdb.gz	DIAP1_HUMAN Protein diaphanous homolog 1 OS=Homo sapiens OX=9606 GN=DIAPH1 PE=1 SV=2
9	AFDB:F1RCU7	0.335	0.333	2.084E-41	1077	0.257	0.254	F1RCU7.pdb.gz
10	AFDB:O70566	0.313	0.305	5.008E-40	1098	0.261	0.254	O70566.pdb.gz	DIAP2_MOUSE Protein diaphanous homolog 2 OS=Mus musculus OX=10090 GN=Diaph2 PE=1 SV=2
11	PDB:4ct7B	0.162	0.554	3.657E-2	269	0.036	0.141	4ct7B.pdb.gz	Structural and Biochemical Insights to the Role of the Ccr4-not Complex and Ddx6 ATPase in Microrna Repression.
12	PDB:3gniA	0.164	0.423	3.818E-2	335	0.022	0.072	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
13	PDB:3zhpA	0.150	0.402	4.160E-2	315	0.032	0.108	3zhpA.pdb.gz
14	PDB:3tpoA	0.165	0.359	4.343E-2	438	0.033	0.080	3tpoA.pdb.gz
15	PDB:7a9wA	0.070	0.110	5.383E-2	513	0.051	0.105	7a9wA.pdb.gz	The pentatricopeptide repeat protein Rmd9 recognizes the dodecameric element in the 3'-UTRs of yeast mitochondrial mRNAs.
16	PDB:5voxP	0.156	0.315	6.124E-2	462	0.039	0.091	5voxP.pdb.gz
17	PDB:5tbkA	0.104	0.201	6.393E-2	417	0.034	0.086	5tbkA.pdb.gz
18	PDB:4hm9A	0.161	0.311	1.071E-1	511	0.045	0.094	4hm9A.pdb.gz
19	PDB:7dvqK	0.123	0.567	1.071E-1	188	0.025	0.144	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:7wug5	0.155	0.204	1.218E-1	782	0.036	0.049	7wug5.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IER9	0.0	768	1060	0.346	0.348	A0A0R4IER9_DANRE Disheveled-associated activator of morphogenesis 1 isoform X2 OS=Danio rerio OX=7955 GN=daam1a PE=4 SV=1
2	A0A1D5P556	0.0	955	1075	0.417	0.414	DAAM2_CHICK Disheveled-associated activator of morphogenesis 2 OS=Gallus gallus OX=9031 GN=DAAM2 PE=1 SV=2
3	B3DJI0	0.0	768	1069	0.346	0.346	B3DJI0_DANRE Daam1l protein OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
4	M9MSM5	0.0	888	1463	0.489	0.357	M9MSM5_DROME Dishevelled associated activator of morphogenesis, isoform D OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
5	Q5BII2	0.0	806	1011	0.434	0.459	Q5BII2_DROME RE67944p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
6	Q5RHJ3	0.0	767	1079	0.346	0.343	Q5RHJ3_DANRE Disheveled-associated activator of morphogenesis 1 OS=Danio rerio OX=7955 GN=daam1l PE=1 SV=1
7	Q7YZA4	0.0	880	1114	0.481	0.461	Q7YZA4_DROME Dishevelled associated activator of morphogenesis, isoform A OS=Drosophila melanogaster OX=7227 GN=DAAM PE=1 SV=1
8	Q80U19	0.0	1862	1115	0.919	0.881	DAAM2_MOUSE Disheveled-associated activator of morphogenesis 2 OS=Mus musculus OX=10090 GN=Daam2 PE=1 SV=4
9	Q86T65	0.0	2199	1068	1.000	1.000	DAAM2_HUMAN Disheveled-associated activator of morphogenesis 2 OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=3
10	Q8BPM0	0.0	776	1077	0.347	0.344	DAAM1_MOUSE Disheveled-associated activator of morphogenesis 1 OS=Mus musculus OX=10090 GN=Daam1 PE=1 SV=4
11	Q8IRY0	0.0	888	1153	0.489	0.453	Q8IRY0_DROME Dishevelled associated activator of morphogenesis, isoform B OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=1
12	Q8MT16	0.0	873	1114	0.479	0.460	Q8MT16_DROME RH61354p OS=Drosophila melanogaster OX=7227 GN=DAAM PE=2 SV=1
13	Q9W5A4	0.0	768	979	0.416	0.454	Q9W5A4_DROME EG:114D9.2 protein OS=Drosophila melanogaster OX=7227 GN=DAAM PE=4 SV=2
14	Q9Y4D1	0.0	780	1078	0.349	0.346	DAAM1_HUMAN Disheveled-associated activator of morphogenesis 1 OS=Homo sapiens OX=9606 GN=DAAM1 PE=1 SV=2
15	Q8IVF7	1.75e-57	218	1028	0.134	0.139	FMNL3_HUMAN Formin-like protein 3 OS=Homo sapiens OX=9606 GN=FMNL3 PE=1 SV=3
16	Q6ZPF4	9.95e-57	216	1028	0.133	0.138	FMNL3_MOUSE Formin-like protein 3 OS=Mus musculus OX=10090 GN=Fmnl3 PE=1 SV=2
17	F8W1F5	4.51e-56	214	1027	0.134	0.139	F8W1F5_HUMAN Formin like 3 OS=Homo sapiens OX=9606 GN=FMNL3 PE=1 SV=1
18	Q6NXC0	1.87e-54	209	1047	0.134	0.137	FMNL3_DANRE Formin-like protein 3 OS=Danio rerio OX=7955 GN=fmnl3 PE=2 SV=2
19	Q6DCB0	9.14e-54	185	132	0.080	0.644	Q6DCB0_HUMAN DAAM2 protein OS=Homo sapiens OX=9606 GN=DAAM2 PE=1 SV=1
20	K7EK60	6.84e-53	199	682	0.118	0.185	K7EK60_HUMAN Formin like 1 OS=Homo sapiens OX=9606 GN=FMNL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06367 Drf_FH3	8.7e-55	196.9	Diaphanous FH3 Domain
2	PF06371 Drf_GBD	4.3e-46	168.4	Diaphanous GTPase-binding Domain
3	PF02181 FH2	2.1e-112	387.6	Formin Homology 2 Domain
4	PF05308 Mito_fiss_reg	0.38	22.5	Mitochondrial fission regulator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381876

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368169	0.953	Segment polarity protein dishevelled homolog DVL-1
2	9606.ENSP00000005340	0.939	Segment polarity protein dishevelled homolog DVL-2
3	9606.ENSP00000316054	0.937	Segment polarity protein dishevelled homolog DVL-3
4	9606.ENSP00000400175	0.933	Transforming protein RhoA
5	9606.ENSP00000378557	0.881	Disheveled-associated activator of morphogenesis 1
6	9606.ENSP00000359000	0.743	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
7	9606.ENSP00000383118	0.727	Cell division control protein 42 homolog
8	9606.ENSP00000285735	0.686	Rho-related GTP-binding protein RhoC
9	9606.ENSP00000387261	0.677	Proline-serine-threonine phosphatase-interacting protein 2
10	9606.ENSP00000452746	0.677	Proline-serine-threonine phosphatase-interacting protein 1
11	9606.ENSP00000377668	0.642	Sulfite oxidase, mitochondrial
12	9606.ENSP00000345985	0.635	Leucine-rich repeat and fibronectin type-III domain-containing protein 2
13	9606.ENSP00000295902	0.617	Prickle planar cell polarity protein 2
14	9606.ENSP00000387266	0.594	Protein spire homolog 1
15	9606.ENSP00000427567	0.587	Microtubule-associated formin which regulates both actin and microtubule dynamics. Induces microtubule acetylation and stabilization and actin stress fiber formation . Regulates Golgi ribbon formation . Required for normal cilia assembly. Early in cilia assembly, may assist in the maturation and positioning of the centrosome/basal body, and once cilia assembly has initiated, may also promote cilia elongation by inhibiting disassembly
16	9606.ENSP00000345064	0.579	Prickle-like protein 1
17	9606.ENSP00000334100	0.564	Exocyst complex component 7
18	9606.ENSP00000296582	0.562	Transmembrane protein 184C
19	9606.ENSP00000355809	0.552	Protein enabled homolog
20	9606.ENSP00000298316	0.550	ADP-ribosylation factor 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0016043	0.978	cellular component organization
GO:0048518	0.960	positive regulation of biological process
GO:0007275	0.957	multicellular organism development
GO:0033043	0.952	regulation of organelle organization
GO:0032956	0.933	regulation of actin cytoskeleton organization
GO:1902903	0.931	regulation of supramolecular fiber organization
GO:0048522	0.924	positive regulation of cellular process
GO:0110053	0.919	regulation of actin filament organization
GO:0044087	0.913	regulation of cellular component biogenesis
GO:0120035	0.904	regulation of plasma membrane bounded cell projection organization
GO:0048731	0.857	system development
GO:0051130	0.844	positive regulation of cellular component organization
GO:0065008	0.836	regulation of biological quality
GO:0007399	0.827	nervous system development
GO:0008064	0.782	regulation of actin polymerization or depolymerization
GO:0032271	0.767	regulation of protein polymerization
GO:0050793	0.656	regulation of developmental process
GO:0048870	0.632	cell motility
GO:0120032	0.567	regulation of plasma membrane bounded cell projection assembly
GO:0051495	0.514	positive regulation of cytoskeleton organization
GO:0090130	0.491	tissue migration
GO:0006996	0.459	organelle organization
GO:0048583	0.443	regulation of response to stimulus
GO:0030833	0.398	regulation of actin filament polymerization
GO:0007417	0.393	central nervous system development
GO:0016477	0.354	cell migration
GO:0051489	0.340	regulation of filopodium assembly
GO:2000249	0.331	regulation of actin cytoskeleton reorganization
GO:0050896	0.327	response to stimulus
GO:0040012	0.323	regulation of locomotion
GO:0048519	0.319	negative regulation of biological process
GO:0048513	0.315	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005737	0.995	cytoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005829	0.992	cytosol
GO:0005856	0.984	cytoskeleton
GO:0005576	0.983	extracellular region
GO:0070062	0.945	extracellular exosome
GO:0016020	0.942	membrane
GO:0015629	0.938	actin cytoskeleton
GO:0005886	0.827	plasma membrane
GO:0043231	0.659	intracellular membrane-bounded organelle
GO:0120025	0.516	plasma membrane bounded cell projection
GO:0012505	0.402	endomembrane system
GO:0001725	0.362	stress fiber
GO:0099512	0.343	supramolecular fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]