StarFunc result for job id Q86T82

User Input

>input (979 residues)
MSPLKIHGPIRIRSMQTGITKWKEGSFEIVEKENKVSLVVHYNTGGIPRIFQLSHNIKNV
VLRPSGAKQSRLMLTLQDNSFLSIDKVPSKDAEEMRLFLDAVHQNRLPAAMKPSQGSGSF
GAILGSRTSQKETSRQLSYSDNQASAKRGSLETKDDIPFRKVLGNPGRGSIKTVAGSGIA
RTIPSLTSTSTPLRSGLLENRTEKRKRMISTGSELNEDYPKENDSSSNNKAMTDPSRKYL
TSSREKQLSLKQSEENRTSGLLPLQSSSFYGSRAGSKEHSSGGTNLDRTNVSSQTPSAKR
SLGFLPQPVPLSVKKLRCNQDYTGWNKPRVPLSSHQQQQLQGFSNLGNTCYMNAILQSLF
SLQSFANDLLKQGIPWKKIPLNALIRRFAHLLVKKDICNSETKKDLLKKVKNAISATAER
FSGYMQNDAHEFLSQCLDQLKEDMEKLNKTWKTEPVSGEENSPDISATRAYTCPVITNLE
FEVQHSIICKACGEIIPKREQFNDLSIDLPRRKKPLPPRSIQDSLDLFFRAEELEYSCEK
CGGKCALVRHKFNRLPRVLILHLKRYSFNVALSLNNKIGQQVIIPRYLTLSSHCTENTKP
PFTLGWSAHMAISRPLKASQMVNSCITSPSTPSKKFTFKSKSSLALCLDSDSEDELKRSV
ALSQRLCEMLGNEQQQEDLEKDSKLCPIEPDKSELENSGFDRMSEEELLAAVLEISKRDA
SPSLSHEDDDKPTSSPDTGFAEDDIQEMPENPDTMETEKPKTITELDPASFTEITKDCDE
NKENKTPEGSQGEVDWLQQYDMEREREEQELQQALAQSLQEQEAWEQKEDDDLKRATELS
LQEFNNSFVDALGSDEDSGNEDVFDMEYTEAEAEELKRNAETGNLPHSYRLISVVSHIGS
TSSSGHYISDVYDIKKQAWFTYNDLEVSKIQEAAVQSDRDRSGYIFFYMHKEIFDELLET
EKNSQSLSTEVGKTTRQAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86T82	1.000	1.000	0.000	979	1.000	1.000	Q86T82.pdb.gz	UBP37_HUMAN Ubiquitin carboxyl-terminal hydrolase 37 OS=Homo sapiens OX=9606 GN=USP37 PE=1 SV=2
2	AFDB:E7F6T8	0.475	0.495	6.907E-98	937	0.555	0.580	E7F6T8.pdb.gz	UBP37_DANRE Ubiquitin carboxyl-terminal hydrolase 37 OS=Danio rerio OX=7955 GN=usp37 PE=2 SV=1
3	AFDB:Q9HBJ7	0.360	0.382	2.635E-72	922	0.414	0.439	Q9HBJ7.pdb.gz	UBP29_HUMAN Ubiquitin carboxyl-terminal hydrolase 29 OS=Homo sapiens OX=9606 GN=USP29 PE=2 SV=1
4	AFDB:Q9BXU7	0.359	0.384	1.381E-64	913	0.374	0.401	Q9BXU7.pdb.gz	UBP26_HUMAN Ubiquitin carboxyl-terminal hydrolase 26 OS=Homo sapiens OX=9606 GN=USP26 PE=1 SV=1
5	AFDB:X2JLM6	0.273	0.460	3.594E-17	565	0.136	0.235	X2JLM6.pdb.gz	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1
6	PDB:5cvnB	0.273	0.793	5.560E-16	321	0.102	0.312	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
7	PDB:3mhsA	0.275	0.573	1.484E-15	455	0.092	0.198	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
8	PDB:5k16B	0.252	0.701	2.070E-14	328	0.097	0.290	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
9	PDB:3ihpB	0.256	0.364	4.981E-14	681	0.099	0.142	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
10	PDB:7w3ax	0.273	0.523	1.474E-13	494	0.096	0.190	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
11	AFDB:Q582C5	0.272	0.271	5.093E-13	986	0.143	0.142	Q582C5.pdb.gz	Q582C5_TRYB2 Ubiquitin carboxyl-terminal hydrolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.500 PE=4 SV=1
12	PDB:5gjqx	0.269	0.693	1.854E-12	355	0.086	0.237	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
13	PDB:7qo48	0.259	0.647	1.952E-12	372	0.089	0.234	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
14	PDB:7ay1D	0.281	0.769	4.238E-12	341	0.091	0.261	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
15	PDB:7yxxA	0.264	0.151	5.488E-12	1754	0.089	0.050	7yxxA.pdb.gz
16	PDB:5mpc8	0.263	0.609	6.085E-12	395	0.089	0.220	5mpc8.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
17	AFDB:Q62728	0.071	0.062	1.023E-4	1175	0.108	0.090	Q62728.pdb.gz	PTN21_RAT Tyrosine-protein phosphatase non-receptor type 21 OS=Rattus norvegicus OX=10116 GN=Ptpn21 PE=1 SV=1
18	AFDB:F1Q6T9	0.075	0.064	2.729E-4	1168	0.103	0.086	F1Q6T9.pdb.gz	F1Q6T9_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=2
19	AFDB:Q16825	0.074	0.063	4.127E-4	1174	0.111	0.093	Q16825.pdb.gz	PTN21_HUMAN Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2
20	AFDB:Q14155	0.079	0.094	4.818E-4	803	0.042	0.051	Q14155.pdb.gz	ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F6T8	0.0	1009	937	0.572	0.598	UBP37_DANRE Ubiquitin carboxyl-terminal hydrolase 37 OS=Danio rerio OX=7955 GN=usp37 PE=2 SV=1
2	Q86T82	0.0	2023	979	1.000	1.000	UBP37_HUMAN Ubiquitin carboxyl-terminal hydrolase 37 OS=Homo sapiens OX=9606 GN=USP37 PE=1 SV=2
3	Q9BXU7	0.0	627	913	0.422	0.452	UBP26_HUMAN Ubiquitin carboxyl-terminal hydrolase 26 OS=Homo sapiens OX=9606 GN=USP26 PE=1 SV=1
4	Q9HBJ7	0.0	701	922	0.448	0.476	UBP29_HUMAN Ubiquitin carboxyl-terminal hydrolase 29 OS=Homo sapiens OX=9606 GN=USP29 PE=2 SV=1
5	Q9ES63	5.08e-141	445	869	0.362	0.407	UBP29_MOUSE Ubiquitin carboxyl-terminal hydrolase 29 OS=Mus musculus OX=10090 GN=Usp29 PE=1 SV=2
6	Q9D9M2	3.83e-18	89.7	370	0.086	0.227	UBP12_MOUSE Ubiquitin carboxyl-terminal hydrolase 12 OS=Mus musculus OX=10090 GN=Usp12 PE=2 SV=2
7	Q9VDD8	9.10e-18	91.3	896	0.077	0.084	Q9VDD8_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=1 SV=2
8	Q8MQX4	1.17e-17	90.9	896	0.077	0.084	Q8MQX4_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
9	H1UUC2	4.11e-17	86.7	367	0.066	0.177	H1UUC2_DROME FI18309p1 OS=Drosophila melanogaster OX=7227 GN=Usp8 PE=2 SV=1
10	Q6P8X6	5.86e-17	86.3	390	0.076	0.190	UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus OX=10090 GN=Usp50 PE=2 SV=1
11	O75317	3.12e-16	84.0	370	0.082	0.216	UBP12_HUMAN Ubiquitin carboxyl-terminal hydrolase 12 OS=Homo sapiens OX=9606 GN=USP12 PE=1 SV=2
12	P62068	4.68e-16	83.2	366	0.082	0.219	UBP46_HUMAN Ubiquitin carboxyl-terminal hydrolase 46 OS=Homo sapiens OX=9606 GN=USP46 PE=1 SV=1
13	P62069	4.68e-16	83.2	366	0.082	0.219	UBP46_MOUSE Ubiquitin carboxyl-terminal hydrolase 46 OS=Mus musculus OX=10090 GN=Usp46 PE=1 SV=1
14	F1M625	2.61e-15	81.3	366	0.079	0.210	UBP46_RAT Ubiquitin carboxyl-terminal hydrolase 46 OS=Rattus norvegicus OX=10116 GN=Usp46 PE=1 SV=2
15	O75604	2.32e-14	79.7	605	0.079	0.127	UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens OX=9606 GN=USP2 PE=1 SV=2
16	Q5U349	2.93e-14	79.3	618	0.076	0.120	UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus OX=10116 GN=Usp2 PE=1 SV=1
17	B2GUX4	3.11e-14	79.3	565	0.072	0.124	UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus OX=10116 GN=Usp21 PE=2 SV=1
18	Q8IQ27	3.62e-14	79.7	938	0.070	0.074	UBP2_DROME Ubiquitin carboxyl-terminal hydrolase Usp2 OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=1 SV=1
19	P34547	3.67e-14	78.2	426	0.081	0.185	UBP46_CAEEL Ubiquitin carboxyl-terminal hydrolase 46 OS=Caenorhabditis elegans OX=6239 GN=usp-46 PE=1 SV=3
20	X2JLM6	3.97e-14	79.0	565	0.070	0.122	X2JLM6_DROME Ubiquitin carboxyl-terminal hydrolase OS=Drosophila melanogaster OX=7227 GN=Usp2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12118 SprA-related	2.8e+02	12.2	SprA-related family
2	PF08271 TF_Zn_Ribbon	7.1e+02	11.2	TFIIB zinc-binding
3	PF00443 UCH	3.1e-70	248.4	Ubiquitin carboxyl-terminal hydrolase
4	PF13423 UCH_1	0.4	21.9	Ubiquitin carboxyl-terminal hydrolase
5	PF16674 UCH_N	9.3e-42	152.6	N-terminal of ubiquitin carboxyl-terminal hydrolase 37
6	PF02809 UIM	0.002	28.9	Ubiquitin interaction motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258399

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310572	0.820	26S proteasome regulatory subunit 8
2	9606.ENSP00000274026	0.818	Cyclin-A2
3	9606.ENSP00000318297	0.804	RuvB-like 1
4	9606.ENSP00000359206	0.797	F-box/WD repeat-containing protein 1A
5	9606.ENSP00000378529	0.746	Fizzy-related protein homolog
6	9606.ENSP00000441543	0.741	Polyubiquitin-C
7	9606.ENSP00000265094	0.692	F-box/WD repeat-containing protein 11
8	9606.ENSP00000380888	0.660	Mediator of RNA polymerase II transcription subunit 13
9	9606.ENSP00000003302	0.648	Ubiquitin carboxyl-terminal hydrolase 28
10	9606.ENSP00000353741	0.633	Eukaryotic peptide chain release factor subunit 1
11	9606.ENSP00000273064	0.626	CCR4-NOT transcription complex subunit 9
12	9606.ENSP00000255465	0.613	Cyclin-A1
13	9606.ENSP00000298767	0.608	Wings apart-like protein homolog
14	9606.ENSP00000215574	0.601	Ubiquitin-conjugating enzyme E2 R1
15	9606.ENSP00000333329	0.600	Ubiquitin carboxyl-terminal hydrolase 17
16	9606.ENSP00000286788	0.588	T-complex protein 1 subunit theta
17	9606.ENSP00000419038	0.583	Elongation factor G, mitochondrial
18	9606.ENSP00000465676	0.581	E3 SUMO-protein ligase PIAS2
19	9606.ENSP00000343535	0.576	Ubiquitin carboxyl-terminal hydrolase 7
20	9606.ENSP00000343526	0.563	Ubiquitin carboxyl-terminal hydrolase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004197	1.000	cysteine-type endopeptidase activity
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0019901	0.995	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0080090	0.990	regulation of primary metabolic process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0036211	0.985	protein modification process
GO:0009987	0.983	cellular process
GO:0019219	0.978	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0070646	0.976	protein modification by small protein removal
GO:0000278	0.955	mitotic cell cycle
GO:0016579	0.955	protein deubiquitination
GO:0051052	0.941	regulation of DNA metabolic process
GO:0044770	0.919	cell cycle phase transition
GO:1903047	0.894	mitotic cell cycle process
GO:0044772	0.726	mitotic cell cycle phase transition
GO:0006275	0.726	regulation of DNA replication
GO:0044843	0.724	cell cycle G1/S phase transition
GO:0000082	0.452	G1/S transition of mitotic cell cycle
GO:0050896	0.341	response to stimulus
GO:0048518	0.314	positive regulation of biological process
GO:0044237	0.314	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.888	protein-containing complex
GO:0005737	0.849	cytoplasm
GO:0005829	0.526	cytosol
GO:0043232	0.356	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]