StarFunc result for job id Q86T96

User Input

>input (592 residues)
MKRSKELITKNHSQEETSILRCWKCRKCIASSGCFMEYLENQVIKDKDDSVDAQNICHVW
HMNVEALPEWISCLIQKAQWTVGKLNCPFCGARLGGFNFVSTPKCSCGQLAAVHLSKSRT
DYQPTQAGRLMRPSVKYLSHPRVQSGCDKEALLTGGGSENRNHRLLNMARNNNDPGRLTE
ALCLEVRPTYFEMKNEKLLSKASEPKYQLFVPQLVTGRCATRAFHRKSHSLDLNISEKLT
LLPTLYEIHSKTTAYSRLNETQPIDLSGLPLQSSKNSYSFQNPSSFDPSMLLQRFSVAPH
ETQTQRGGEFQCGLEAASVYSDHTNTNNLTFLMDLPSAGRSMPEASDQEEHLSPLDFLHS
ANFSLGSINQRLNKRERSKLKNLRRKQRRRERWLQKQGKYSGVGLLDHMTLNNEMSTDED
NEYAEEKDSYICAVCLDVYFNPYMCYPCHHIFCEPCLRTLAKDNPSSTPCPLCRTIISRV
FFQTELNNATKTFFTKEYLKIKQSFQKSNSAKWPLPSCRKAFHLFGGFRRHAAPVTRRQF
PHGAHRMDYLHFEDDSRGWWFDMDMVIIYIYSVNWVIGFIVFCFLCYFFFPF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3U827	0.249	0.249	2.455E-80	592	0.821	0.821	Q3U827.pdb.gz	RN180_MOUSE E3 ubiquitin-protein ligase RNF180 OS=Mus musculus OX=10090 GN=Rnf180 PE=1 SV=2
2	PDB:6n8mY	0.153	0.633	1.733E-7	128	0.064	0.297	6n8mY.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
3	PDB:4r8pL	0.115	0.253	3.742E-4	254	0.034	0.079	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
4	PDB:5dkaA	0.103	0.561	1.173E-3	96	0.037	0.229	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
5	PDB:7qcdC	0.105	0.223	6.504E-3	267	0.022	0.049	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
6	AFDB:Q7KQN5	0.056	0.034	1.522E-2	1150	0.167	0.086	Q7KQN5.pdb.gz	Q7KQN5_DROME Datilografo, isoform A OS=Drosophila melanogaster OX=7227 GN=dati PE=2 SV=1
7	PDB:8a3tU	0.085	0.371	2.172E-2	114	0.034	0.175	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
8	PDB:5gm6a	0.096	0.402	2.314E-2	123	0.034	0.163	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
9	PDB:7jzvA	0.105	0.232	3.844E-2	253	0.039	0.091	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
10	PDB:3m62A	0.095	0.060	4.650E-2	955	0.015	0.009	3m62A.pdb.gz
11	PDB:7o4iW	0.063	0.113	6.386E-2	312	0.029	0.054	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
12	AFDB:Q8IRB5	0.060	0.031	1.088E-1	1465	0.120	0.048	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
13	AFDB:Q7Z4V0	0.051	0.042	1.159E-1	828	0.149	0.106	Q7Z4V0.pdb.gz	ZN438_HUMAN Zinc finger protein 438 OS=Homo sapiens OX=9606 GN=ZNF438 PE=1 SV=1
14	PDB:5lj5t	0.078	0.105	1.204E-1	438	0.024	0.032	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
15	AFDB:A0A1D8PL95	0.066	0.066	1.316E-1	601	0.095	0.093	A0A1D8PL95.pdb.gz	A0A1D8PL95_CANAL Rlm1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RLM1 PE=4 SV=1
16	AFDB:F1QTC9	0.059	0.043	2.818E-1	859	0.142	0.098	F1QTC9.pdb.gz
17	AFDB:M9PHN7	0.083	0.084	2.818E-1	585	0.133	0.135	M9PHN7.pdb.gz	M9PHN7_DROME Protein interacting with Ttk69 and Sin3A, isoform E OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
18	AFDB:Q940A7	0.044	0.041	4.681E-1	683	0.115	0.100	Q940A7.pdb.gz	TA12B_ARATH Transcription initiation factor TFIID subunit 12b OS=Arabidopsis thaliana OX=3702 GN=TAF12B PE=1 SV=1
19	AFDB:A0A1D5PRD7	0.075	0.063	5.314E-1	772	0.137	0.105	A0A1D5PRD7.pdb.gz	A0A1D5PRD7_CHICK Glucocorticoid receptor OS=Gallus gallus OX=9031 GN=NR3C1 PE=1 SV=1
20	AFDB:Q96T23	0.067	0.037	6.429E-1	1441	0.135	0.056	Q96T23.pdb.gz	RSF1_HUMAN Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3U827	0.0	984	592	0.816	0.816	RN180_MOUSE E3 ubiquitin-protein ligase RNF180 OS=Mus musculus OX=10090 GN=Rnf180 PE=1 SV=2
2	Q02256	2.06e-08	58.9	364	0.069	0.113	PVH1_YEAST Tyrosine-protein phosphatase YVH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YVH1 PE=1 SV=1
3	F4ICB5	6.42e-06	51.2	491	0.074	0.090	F4ICB5_ARATH Zinc finger (C3HC4-type RING finger) family protein OS=Arabidopsis thaliana OX=3702 GN=IAP1 PE=1 SV=1
4	A0A1D8PSH7	7.52e-06	50.4	322	0.061	0.112	A0A1D8PSH7_CANAL protein-tyrosine-phosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YVH1 PE=3 SV=1
5	Q8NHY2	3.78e-05	49.3	731	0.044	0.036	COP1_HUMAN E3 ubiquitin-protein ligase COP1 OS=Homo sapiens OX=9606 GN=COP1 PE=1 SV=1
6	Q9R1A8	4.57e-05	48.9	733	0.044	0.035	COP1_MOUSE E3 ubiquitin-protein ligase COP1 OS=Mus musculus OX=10090 GN=Cop1 PE=1 SV=2
7	F1QFW2	5.23e-05	48.5	744	0.042	0.034	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1
8	Q58ER5	7.62e-05	48.1	744	0.042	0.034	Q58ER5_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=zgc:113099 PE=2 SV=1
9	Q9C040	1.41e-04	47.4	744	0.042	0.034	TRIM2_HUMAN Tripartite motif-containing protein 2 OS=Homo sapiens OX=9606 GN=TRIM2 PE=1 SV=1
10	Q90X96	1.52e-04	47.4	1579	0.035	0.013	Q90X96_XENLA RING-type E3 ubiquitin transferase BRCA1 OS=Xenopus laevis OX=8355 GN=brca1.L PE=1 SV=1
11	D3ZQG6	1.72e-04	47.0	744	0.042	0.034	TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Trim2 PE=1 SV=2
12	Q9ESN6	1.77e-04	47.0	744	0.042	0.034	TRIM2_MOUSE Tripartite motif-containing protein 2 OS=Mus musculus OX=10090 GN=Trim2 PE=1 SV=1
13	E7F1U3	3.23e-04	46.2	774	0.039	0.030	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
14	Q14527	4.93e-04	45.8	1009	0.030	0.018	HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=2
15	A0A0C4DGA6	5.02e-04	45.8	1008	0.030	0.018	A0A0C4DGA6_HUMAN Helicase like transcription factor OS=Homo sapiens OX=9606 GN=HLTF PE=1 SV=1
16	Q9R1R2	5.98e-04	45.4	744	0.047	0.038	TRIM3_MOUSE Tripartite motif-containing protein 3 OS=Mus musculus OX=10090 GN=Trim3 PE=1 SV=1
17	O70277	7.74e-04	45.1	744	0.049	0.039	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1
18	O75382	8.01e-04	45.1	744	0.049	0.039	TRIM3_HUMAN Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3 PE=1 SV=2
19	P28284	0.001	44.7	825	0.042	0.030	ICP0_HHV2H E3 ubiquitin-protein ligase ICP0 OS=Human herpesvirus 2 (strain HG52) OX=10315 GN=RL2 PE=1 SV=1
20	Q5F338	0.001	43.5	305	0.037	0.072	Q5F338_CHICK Uncharacterized protein OS=Gallus gallus OX=9031 GN=RCJMB04_37m20 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19332 RNF180_C	8.5e-48	172.2	E3 ubiquitin-protein ligase RNF180 C-terminus
2	PF00097 zf-C3HC4	0.0049	28.0	Zinc finger, C3HC4 type (RING finger)
3	PF13923 zf-C3HC4_2	0.014	26.5	Zinc finger, C3HC4 type (RING finger)
4	PF13920 zf-C3HC4_3	0.0011	30.0	Zinc finger, C3HC4 type (RING finger)
5	PF13639 zf-RING_2	0.086	24.5	Ring finger domain
6	PF14634 zf-RING_5	0.48	21.7	zinc-RING finger domain
7	PF13445 zf-RING_UBOX	0.0065	27.8	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000373752

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420849	0.621	Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family
2	9606.ENSP00000373726	0.567	Membrane protein FAM159B
3	9606.ENSP00000302144	0.565	Transmembrane protein 154
4	9606.ENSP00000348033	0.562	Olfactory receptor 11L1
5	9606.ENSP00000312672	0.548	Transmembrane protein 136
6	9606.ENSP00000362047	0.535	XK-related protein 2
7	9606.ENSP00000454014	0.522	Protein shisa-9
8	9606.ENSP00000427401	0.512	Protein SREK1IP1
9	9606.ENSP00000380690	0.509	BICD family-like cargo adapter 1
10	9606.ENSP00000376522	0.506	Centrosomal protein 112

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031624	1.000	ubiquitin conjugating enzyme binding
GO:0061630	0.999	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.983	cellular process
GO:0071704	0.976	organic substance metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0048522	0.969	positive regulation of cellular process
GO:0044237	0.959	cellular metabolic process
GO:0031323	0.940	regulation of cellular metabolic process
GO:0044238	0.939	primary metabolic process
GO:0016567	0.927	protein ubiquitination
GO:0051246	0.906	regulation of protein metabolic process
GO:0009893	0.905	positive regulation of metabolic process
GO:0009894	0.852	regulation of catabolic process
GO:0051247	0.807	positive regulation of protein metabolic process
GO:1903050	0.788	regulation of proteolysis involved in protein catabolic process
GO:0042176	0.773	regulation of protein catabolic process
GO:0045862	0.769	positive regulation of proteolysis
GO:1903052	0.748	positive regulation of proteolysis involved in protein catabolic process
GO:0061136	0.745	regulation of proteasomal protein catabolic process
GO:2000058	0.745	regulation of ubiquitin-dependent protein catabolic process
GO:0045732	0.712	positive regulation of protein catabolic process
GO:1901800	0.671	positive regulation of proteasomal protein catabolic process
GO:2000060	0.671	positive regulation of ubiquitin-dependent protein catabolic process
GO:0032434	0.570	regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0006725	0.527	cellular aromatic compound metabolic process
GO:1901360	0.525	organic cyclic compound metabolic process
GO:0032501	0.497	multicellular organismal process
GO:0031401	0.484	positive regulation of protein modification process
GO:0046483	0.442	heterocycle metabolic process
GO:0031396	0.382	regulation of protein ubiquitination
GO:0034641	0.375	cellular nitrogen compound metabolic process
GO:0031398	0.372	positive regulation of protein ubiquitination
GO:1901160	0.355	primary amino compound metabolic process
GO:0032436	0.355	positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0065009	0.345	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.958	endomembrane system
GO:0031090	0.946	organelle membrane
GO:0005783	0.919	endoplasmic reticulum
GO:0031984	0.889	organelle subcompartment
GO:0005789	0.873	endoplasmic reticulum membrane
GO:0005634	0.409	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]