StarFunc result for job id Q86TB3

User Input

>input (2170 residues)
MKDSEGPQRPPLCFLSTLLSQKVPEKSDAVLRCIISGQPKPEVTWYKNGQAIDGSGIISN
YEFFENQYIHVLHLSCCTKNDAAVYQISAKNSFGMICCSASVEVECSSENPQLSPNLEDD
RDRGWKHETGTHEEERANQIDEKEHPYKEEESISPGTPRSADSSPSKSNHSLSLQSLGNL
DISVSSSENPLGVKGTRHTGEAYDPSNTEEIANGLLFLNSSHIYEKQDRCCHKTVHSMAS
KFTDGDLNNDGPHDEGLRSSQQNPKVQKYISFSLPLSEATAHIYPGDSAVANKQPSPQLS
SEDSDSDYELCPEITLTYTEEFSDDDLEYLECSDVMTDYSNAVWQRNLLGTEHVFLLESD
DEEMEFGEHCLGGCEHFLSGMGCGSRVSGDAGPMVATAGFCGHHSQPQEVGVRSSRVSKH
GPSSPQTGMTLILGPHQDGTSSVTEQGRYKLPTAPEAAENDYPGIQGETRDSHQAREEFA
SDNLLNMDESVRETEMKLLSGESENSGMSQCWETAADKRVGGKDLWSKRGSRKSARVRQP
GMKGNPKKPNANLRESTTEGTLHLCSAKESAEPPLTQSDKRETSHTTAAATGRSSHADAR
ECAISTQAEQEAKTLQTSTDSVSKEGNTNCKGEGMQVNTLFETSQVPDWSDPPQVQVQET
VRETISCSQMPAFSEPAGEESPFTGTTTISFSNLGGVHKENASLAQHSEVKPCTCGPQHE
EKQDRDGNIPDNFREDLKYEQSISEANDETMSPGVFSRHLPKDARADFREPVAVSVASPE
PTDTALTLENVCDEPRDREAVCAMECFEAGDQGTCFDTIDSLVGRPVDKYSPQEICSVDT
ELAEGQNKVSDLCSSNDKTLEVFFQTQVSETSVSTCKSSKDGNSVMSPLFTSTFTLNISH
TASEGATGENLAKVENSTYPLASTVHAGQEQPSPSNSGGLDETQLLSSENNPLVQFKEGG
DKSPSPSAADTTATPASYSSIVSFPWEKPTTLTANNECFQATRETEDTSTVTIATEVHPA
KYLAVSIPEDKHAGGTEERFPRASHEKVSQFPSQVQLDHILSGATIKSTKELLCRAPSVP
GVPHHVLQLPEGEGFCSNSPLQVDNLSGDKSQTVDRADFRSYEENFQERGSETKQGVQQQ
SLSQQGSLSAPDFQQSLPTTSAAQEERNLVPTAHSPASSREGAGQRSGWGTRVSVVAETA
GEEDSQALSNVPSLSDILLEESKEYRPGNWEAGNKLKIITLEASASEIWPPRQLTNSESK
ASDGGLIIPDKVWAVPDSLKADAVVPELAPSEIAALAHSPEDAESALADSRESHKGEEPT
ISVHWRSLSSRGFSQPRLLESSVDPVDEKELSVTDSLSAASETGGKENVNNVSQDQEEKQ
LKMDHTAFFKKFLTCPKILESSVDPIDEISVIEYTRAGKPEPSETTPQGAREGGQSNDGN
MGHEAEIQPAILQVPCLQGTILSENRISRSQEGSMKQEAEQIQPEEAKTAIWQVLQPSEG
GERIPSGCSIGQIQESSDGSLGEAEQSKKDKAELISPTSPLSSCLPIMTHASLGVDTHNS
TGQIHDVPENDIVEPRKRQYVFPVSQKRGTIENERGKPLPSSPDLTRFPCTSSPEGNVTD
FLISHKMEEPKIEVLQIGETKPPSSSSSSAKTLAFISGERELEKAPKLLQDPCQKGTLGC
AKKSREREKSLEARAGKSPGTLTAVTGSEEVKRKPEAPGSGHLAEGVKKKILSRVAALRL
KLEEKENIRKNSAFLKKMPKLETSLSHTEEKQDPKKPSCKREGRAPVLLKKIQAEMFPEH
SGNVKLSCQFAEIHEDSTICWTKDSKSIAQVQRSAGDNSTVSFAIVQASPKDQGLYYCCI
KNSYGKVTAEFNLTAEVLKQLSSRQDTKGCEEIEFSQLIFKEDFLHDSYFGGRLRGQIAT
EELHFGEGVHRKAFRSTVMHGLMPVFKPGHACVLKVHNAIAYGTRNNDELIQRNYKLAAQ
ECYVQNTARYYAKIYAAEAQPLEGFGEVPEIIPIFLIHRPENNIPYATVEEELIGEFVKY
SIRDGKEINFLRRESEAGQKCCTFQHWVYQKTSGCLLVTDMQGVGMKLTDVGIATLAKGY
KGFKGNCSMTFIDQFKALHQCNKYCKMLGLKSLQNNNQKQKQPSIGKSKVQTNSMTIKKA
GPETPGEKKT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86TB3	1.000	1.000	0.000	2170	1.000	1.000	Q86TB3.pdb.gz	ALPK2_HUMAN Alpha-protein kinase 2 OS=Homo sapiens OX=9606 GN=ALPK2 PE=1 SV=3
2	AFDB:F1QU13	0.122	0.134	1.685E-52	1966	0.206	0.227	F1QU13.pdb.gz	ALPK2_DANRE Alpha-protein kinase 2 OS=Danio rerio OX=7955 GN=alpk2 PE=2 SV=2
3	AFDB:Q924C5	0.163	0.209	8.810E-50	1678	0.203	0.262	Q924C5.pdb.gz	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
4	AFDB:Q90X22	0.062	0.092	6.930E-9	1276	0.079	0.135	Q90X22.pdb.gz
5	PDB:4edqA	0.042	0.184	1.576E-6	483	0.009	0.039	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
6	PDB:6sm1A	0.036	0.544	9.165E-5	111	0.009	0.171	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
7	AFDB:Q3V1M1	0.036	0.031	1.358E-4	2594	0.083	0.069	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
8	PDB:5ir3A	0.040	0.639	2.601E-4	111	0.010	0.189	5ir3A.pdb.gz
9	AFDB:E7F5U2	0.039	0.035	2.773E-4	2497	0.069	0.060	E7F5U2.pdb.gz
10	PDB:4aizA	0.035	0.537	3.240E-4	107	0.012	0.243	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.
11	PDB:5c6wJ	0.037	0.298	3.616E-4	238	0.009	0.080	5c6wJ.pdb.gz
12	AFDB:B7Z0K1	0.044	0.077	4.073E-4	1137	0.063	0.120	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
13	PDB:1cd0A	0.039	0.619	4.504E-4	111	0.007	0.144	1cd0A.pdb.gz
14	PDB:2cd0A	0.040	0.640	4.504E-4	111	0.009	0.180	2cd0A.pdb.gz
15	PDB:4y5xB	0.037	0.559	4.759E-4	111	0.010	0.189	4y5xB.pdb.gz
16	PDB:6dldD	0.036	0.264	4.759E-4	269	0.010	0.082	6dldD.pdb.gz
17	PDB:1jrhL	0.041	0.417	1.084E-3	167	0.007	0.096	1jrhL.pdb.gz
18	AFDB:O88466	0.035	0.038	2.494E-3	1888	0.109	0.126	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
19	AFDB:Q04164	0.043	0.052	2.634E-3	1693	0.092	0.118	Q04164.pdb.gz	SAS_DROME Putative epidermal cell surface receptor OS=Drosophila melanogaster OX=7227 GN=sas PE=2 SV=2
20	AFDB:Q8TEP8	0.037	0.033	4.318E-3	2537	0.103	0.088	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86TB3	0.0	4498	2170	1.000	1.000	ALPK2_HUMAN Alpha-protein kinase 2 OS=Homo sapiens OX=9606 GN=ALPK2 PE=1 SV=3
2	F1QU13	1.04e-128	452	1966	0.095	0.105	ALPK2_DANRE Alpha-protein kinase 2 OS=Danio rerio OX=7955 GN=alpk2 PE=2 SV=2
3	Q924C5	5.88e-93	338	1680	0.079	0.102	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2
4	Q9BX84	8.18e-12	73.6	2022	0.029	0.031	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
5	Q54DK4	1.25e-10	69.7	1352	0.032	0.051	AK1_DICDI Alpha-protein kinase 1 OS=Dictyostelium discoideum OX=44689 GN=ak1 PE=3 SV=1
6	Q925B3	1.36e-10	69.7	1862	0.022	0.026	TRPM7_RAT Transient receptor potential cation channel subfamily M member 7 OS=Rattus norvegicus OX=10116 GN=Trpm7 PE=1 SV=2
7	Q923J1	1.53e-10	69.3	1863	0.022	0.026	TRPM7_MOUSE Transient receptor potential cation channel subfamily M member 7 OS=Mus musculus OX=10090 GN=Trpm7 PE=1 SV=1
8	Q96QT4	1.69e-10	69.3	1865	0.022	0.026	TRPM7_HUMAN Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1
9	Q8CIR4	3.31e-10	68.6	2028	0.041	0.044	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
10	Q563W7	4.34e-10	67.8	1774	0.022	0.026	Q563W7_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=tct PE=2 SV=1
11	A0A8I5ZU83	8.96e-10	67.0	26931	0.016	0.001	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
12	A0A8I5ZUN3	9.85e-10	67.0	35375	0.016	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
13	A2ASS6	9.85e-10	67.0	35213	0.016	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
14	Q8WZ42	1.17e-09	66.6	34350	0.016	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
15	F1N9Z6	9.61e-08	60.1	1587	0.016	0.022	F1N9Z6_CHICK Myomesin 1 OS=Gallus gallus OX=9031 GN=MYOM1 PE=4 SV=4
16	Q63638	4.84e-07	58.2	3259	0.017	0.011	SPEG_RAT Striated muscle-specific serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Speg PE=1 SV=2
17	Q6PDN3	6.64e-07	57.4	1941	0.016	0.018	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
18	P52179	9.66e-07	57.0	1685	0.016	0.021	MYOM1_HUMAN Myomesin-1 OS=Homo sapiens OX=9606 GN=MYOM1 PE=1 SV=2
19	Q62407	1.20e-06	56.6	3262	0.016	0.011	SPEG_MOUSE Striated muscle-specific serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Speg PE=1 SV=2
20	O08796	1.21e-06	56.2	724	0.024	0.072	EF2K_MOUSE Eukaryotic elongation factor 2 kinase OS=Mus musculus OX=10090 GN=Eef2k PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02816 Alpha_kinase	3.4e-34	130.1	Alpha-kinase family
2	PF08205 C2-set_2	43	15.6	CD80-like C2-set immunoglobulin domain
3	PF07679 I-set	8e-20	82.0	Immunoglobulin I-set domain
4	PF00047 ig	2.7e-05	35.6	Immunoglobulin domain
5	PF13895 Ig_2	5.7e-09	47.5	Immunoglobulin domain
6	PF13927 Ig_3	3.2e-16	71.0	Immunoglobulin domain
7	PF07686 V-set	1.2	20.8	Immunoglobulin V-set domain
8	PF15910 V-set_2	4.8e+02	12.2	ICOS V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354991

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282020	0.699	Glutamate receptor ionotropic, delta-2
2	9606.ENSP00000398048	0.601	Alpha-protein kinase 1
3	9606.ENSP00000361214	0.565	Pro-neuregulin-3, membrane-bound isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.579	catalytic activity
GO:0140096	0.488	catalytic activity, acting on a protein
GO:0016740	0.351	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.989	biological regulation
GO:0050794	0.982	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0048856	0.940	anatomical structure development
GO:0032501	0.938	multicellular organismal process
GO:0055006	0.932	cardiac cell development
GO:0014706	0.920	striated muscle tissue development
GO:0023051	0.894	regulation of signaling
GO:0048738	0.892	cardiac muscle tissue development
GO:0010646	0.891	regulation of cell communication
GO:0061061	0.873	muscle structure development
GO:0055001	0.862	muscle cell development
GO:0055007	0.814	cardiac muscle cell differentiation
GO:0009966	0.727	regulation of signal transduction
GO:0048523	0.642	negative regulation of cellular process
GO:0009653	0.453	anatomical structure morphogenesis
GO:0051239	0.404	regulation of multicellular organismal process
GO:0055013	0.392	cardiac muscle cell development
GO:0009968	0.318	negative regulation of signal transduction
GO:0019222	0.305	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098590	0.995	plasma membrane region
GO:0016323	0.993	basolateral plasma membrane
GO:0005622	0.942	intracellular anatomical structure
GO:0043226	0.939	organelle
GO:0043229	0.731	intracellular organelle
GO:0005737	0.717	cytoplasm
GO:0043227	0.555	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.351	Transferases.

[back to server]