StarFunc result for job id Q86TB9

User Input

>input (770 residues)
MFRYESLEDCPLDEDEDAFQGLGEEDEEIDQFNDDTFGSGAVDDDWQEAHERLAELEEKL
PVAVNEQTGNGERDEMDLLGDHEENLAERLSKMVIENELEDPAIMRAVQTRPVLQPQPGS
LNSSIWDGSEVLRRIRGPLLAQEMPTVSVLEYALPQRPPQGPEDDRDLSERALPRRSTSP
IIGSPPVRAVPIGTPPKQMAVPSFTQQILCPKPVHVRPPMPPRYPAPYGERMSPNQLCSV
PNSSLLGHPFPPSVPPVLSPLQRAQLLGGAQLQPGRMSPSQFARVPGFVGSPLAAMNPKL
LQGRVGQMLPPAPGFRAFFSAPPSATPPPQQHPPGPGPHLQNLRSQAPMFRPDTTHLHPQ
HRRLLHQRQQQNRSQHRNLNGAGDRGSHRSSHQDHLRKDPYANLMLQREKDWVSKIQMMQ
LQSTDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKERTKLITPQVAKLEHAYKPVQFEG
SLGKLTVSSVNNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYE
RRYLLSLEEERPALMDDRKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARI
LPFLSTEQAADILMTTARNLPFLIKKDAQDEVLPCLLSPFSLLLYHLPSVSITSLLRQLM
NLPQSAATPALSNPHLTAVLQNKFGLSLLLILLSRGEDLQSSDPATESTQNNQWTEVMFM
ATRELLRIPQAALAKPISIPTNLVSLFSRYVDRQKLNLLETKLQLVQGIR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86TB9	1.000	1.000	1.762E-93	770	1.000	1.000	Q86TB9.pdb.gz	PATL1_HUMAN Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1 PE=1 SV=2
2	AFDB:Q94C98	0.256	0.252	5.186E-12	787	0.186	0.182	Q94C98.pdb.gz	PATH2_ARATH Protein PAT1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=PAT1H2 PE=2 SV=1
3	AFDB:Q0WPK4	0.295	0.288	2.021E-11	793	0.210	0.204	Q0WPK4.pdb.gz	PAT1H_ARATH Protein PAT1 homolog OS=Arabidopsis thaliana OX=3702 GN=PAT1 PE=1 SV=1
4	AFDB:Q54WA7	0.113	0.111	5.803E-5	785	0.121	0.118	Q54WA7.pdb.gz	Q54WA7_DICDI RNA binding protein OS=Dictyostelium discoideum OX=44689 GN=pufA PE=4 SV=1
5	AFDB:P25339	0.181	0.161	1.068E-4	888	0.142	0.123	P25339.pdb.gz	PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF4 PE=1 SV=2
6	AFDB:A0A0R4IZ84	0.129	0.082	2.370E-4	1544	0.139	0.069	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
7	AFDB:Q9C5E7	0.173	0.158	6.653E-4	861	0.148	0.132	Q9C5E7.pdb.gz	PUM6_ARATH Pumilio homolog 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APUM6 PE=1 SV=1
8	AFDB:O94462	0.103	0.107	1.409E-3	732	0.136	0.143	O94462.pdb.gz	PUF3_SCHPO mRNA-binding protein puf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=puf3 PE=2 SV=4
9	AFDB:Q14669	0.115	0.059	1.477E-3	1992	0.134	0.052	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
10	AFDB:G5E870	0.101	0.055	1.548E-3	2025	0.143	0.054	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
11	PDB:3gniA	0.081	0.154	2.201E-2	335	0.043	0.099	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
12	PDB:7ajlAAA	0.089	0.176	3.203E-2	290	0.044	0.117	7ajlAAA.pdb.gz
13	PDB:4abnB	0.106	0.159	3.687E-2	426	0.042	0.075	4abnB.pdb.gz
14	PDB:7p46A	0.070	0.146	6.784E-2	281	0.038	0.103	7p46A.pdb.gz	Binding of l-kynurenine to X. campestris tryptophan 2,3-dioxygenase.
15	PDB:1keyB	0.090	0.203	8.989E-2	221	0.042	0.145	1keyB.pdb.gz
16	PDB:3msvA	0.106	0.179	1.084E-1	352	0.039	0.085	3msvA.pdb.gz
17	PDB:6wucI	0.083	0.087	1.654E-1	713	0.045	0.049	6wucI.pdb.gz
18	PDB:3axjB	0.083	0.199	1.817E-1	240	0.032	0.104	3axjB.pdb.gz
19	PDB:3axyC	0.107	0.261	1.996E-1	235	0.034	0.111	3axyC.pdb.gz	14-3-3 proteins act as intracellular receptors for rice Hd3a florigen
20	PDB:6fyxo	0.142	0.192	1.996E-1	529	0.051	0.074	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q32N92	0.0	734	718	0.552	0.592	PATL1_XENLA Protein PAT1 homolog 1 OS=Xenopus laevis OX=8355 GN=patl1 PE=1 SV=2
2	Q86TB9	0.0	1569	770	1.000	1.000	PATL1_HUMAN Protein PAT1 homolog 1 OS=Homo sapiens OX=9606 GN=PATL1 PE=1 SV=2
3	Q4V7K4	1.14e-83	283	733	0.325	0.341	PATL2_XENLA Protein PAT1 homolog 2 OS=Xenopus laevis OX=8355 GN=patl2 PE=1 SV=1
4	C9JE40	8.05e-66	230	543	0.222	0.315	PATL2_HUMAN Protein PAT1 homolog 2 OS=Homo sapiens OX=9606 GN=PATL2 PE=1 SV=1
5	A2ARM1	3.51e-53	195	529	0.168	0.244	PATL2_MOUSE Protein PAT1 homolog 2 OS=Mus musculus OX=10090 GN=Patl2 PE=2 SV=1
6	Q7KK29	1.28e-17	90.1	919	0.138	0.115	Q7KK29_DROME BcDNA.LD27979 OS=Drosophila melanogaster OX=7227 GN=Patr-1 PE=2 SV=1
7	Q9VEN9	1.45e-17	90.1	968	0.138	0.110	Q9VEN9_DROME Protein associated with topo II related-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Patr-1 PE=1 SV=1
8	O42958	2.46e-16	85.9	754	0.129	0.131	PAT1_SCHPO DNA topoisomerase 2-associated protein pat1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC19G7.10c PE=3 SV=2
9	Q5B9M9	1.05e-10	67.8	819	0.136	0.128	Q5B9M9_EMENI Topisomerase II associated protein (Pat1), putative (AFU_orthologue AFUA_5G10770) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02751 PE=3 SV=1
10	Q20374	1.20e-07	57.8	833	0.086	0.079	PATR1_CAEEL Protein PAT1 homolog 1 OS=Caenorhabditis elegans OX=6239 GN=patr-1 PE=1 SV=2
11	Q94C98	5.06e-07	55.8	787	0.095	0.093	PATH2_ARATH Protein PAT1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=PAT1H2 PE=2 SV=1
12	F4J077	1.43e-06	54.3	782	0.092	0.091	PATH1_ARATH Protein PAT1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=PAT1H1 PE=1 SV=1
13	Q0WPK4	1.78e-05	50.8	793	0.074	0.072	PAT1H_ARATH Protein PAT1 homolog OS=Arabidopsis thaliana OX=3702 GN=PAT1 PE=1 SV=1
14	P25644	0.002	44.3	796	0.071	0.069	PAT1_YEAST DNA topoisomerase 2-associated protein PAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAT1 PE=1 SV=4
15	A0A8I5ZUN3	0.007	42.7	35375	0.052	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
16	M9PC48	0.026	40.8	18095	0.061	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
17	M9PCJ6	0.026	40.8	18641	0.061	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PBZ0	0.092	38.9	22830	0.061	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PC45	0.092	38.9	22300	0.061	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PEH5	0.092	38.9	20710	0.061	0.002	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09770 PAT1	1.8e-15	68.1	Topoisomerase II-associated protein PAT1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300146

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264951	0.999	5'-3' exoribonuclease 1
2	9606.ENSP00000310596	0.999	U6 snRNA-associated Sm-like protein LSm1
3	9606.ENSP00000364813	0.999	U6 snRNA-associated Sm-like protein LSm2
4	9606.ENSP00000373715	0.999	m7GpppN-mRNA hydrolase
5	9606.ENSP00000478754	0.999	Probable ATP-dependent RNA helicase DDX6
6	9606.ENSP00000422392	0.996	U6 snRNA-associated Sm-like protein LSm6
7	9606.ENSP00000469468	0.996	U6 snRNA-associated Sm-like protein LSm4
8	9606.ENSP00000302160	0.995	U6 snRNA-associated Sm-like protein LSm3
9	9606.ENSP00000252622	0.994	U6 snRNA-associated Sm-like protein LSm7
10	9606.ENSP00000476046	0.993	mRNA-decapping enzyme 1A
11	9606.ENSP00000320503	0.992	Enhancer of mRNA-decapping protein 3
12	9606.ENSP00000351811	0.992	Enhancer of mRNA-decapping protein 4
13	9606.ENSP00000410758	0.992	U6 snRNA-associated Sm-like protein LSm5
14	9606.ENSP00000280665	0.986	mRNA-decapping enzyme 1B
15	9606.ENSP00000446271	0.937	Protein LSM14 homolog A
16	9606.ENSP00000320949	0.905	CCR4-NOT transcription complex subunit 1
17	9606.ENSP00000351159	0.885	CCR4-NOT transcription complex subunit 3
18	9606.ENSP00000315379	0.865	U4/U6 small nuclear ribonucleoprotein Prp3
19	9606.ENSP00000362300	0.835	Protein argonaute-1
20	9606.ENSP00000380659	0.824	Eukaryotic translation initiation factor 4E transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0034046	1.000	poly(G) binding
GO:0008266	1.000	poly(U) RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.996	regulation of biological process
GO:0071704	0.995	organic substance metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0044238	0.993	primary metabolic process
GO:0050794	0.993	regulation of cellular process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:0071840	0.979	cellular component organization or biogenesis
GO:0060255	0.979	regulation of macromolecule metabolic process
GO:0010629	0.969	negative regulation of gene expression
GO:0016070	0.967	RNA metabolic process
GO:0048518	0.966	positive regulation of biological process
GO:0044085	0.966	cellular component biogenesis
GO:0051248	0.966	negative regulation of protein metabolic process
GO:0010608	0.965	post-transcriptional regulation of gene expression
GO:2000113	0.965	negative regulation of cellular macromolecule biosynthetic process
GO:0017148	0.963	negative regulation of translation
GO:0016043	0.962	cellular component organization
GO:0044260	0.962	cellular macromolecule metabolic process
GO:0051173	0.955	positive regulation of nitrogen compound metabolic process
GO:0043488	0.955	regulation of mRNA stability
GO:0022607	0.948	cellular component assembly
GO:0061014	0.945	positive regulation of mRNA catabolic process
GO:0034655	0.942	nucleobase-containing compound catabolic process
GO:0016071	0.936	mRNA metabolic process
GO:0006402	0.931	mRNA catabolic process
GO:0061157	0.926	mRNA destabilization
GO:0000956	0.918	nuclear-transcribed mRNA catabolic process
GO:0006996	0.860	organelle organization
GO:0070925	0.836	organelle assembly
GO:0140694	0.778	non-membrane-bounded organelle assembly
GO:0000288	0.740	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0110154	0.648	RNA decapping
GO:0110156	0.628	methylguanosine-cap decapping

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.999	cytosol
GO:0000932	0.998	P-body
GO:0140535	0.944	intracellular protein-containing complex
GO:0030014	0.893	CCR4-NOT complex
GO:0005634	0.853	nucleus
GO:0070013	0.568	intracellular organelle lumen
GO:0016020	0.396	membrane
GO:0031981	0.312	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]