StarFunc result for job id Q86TC9

User Input

>input (1320 residues)
MQDDSIEASTSISQLLRESYLAETRHRGNNERSRAEPSSNPCHFGSPSGAAEGGGGQDDL
PDLSAFLSQEELDESVNLARLAINYDPLEKADETQARKRLSPDQMKHSPNLSFEPNFCQD
NPRSPTSSKESPQEAKRPQYCSETQSKKVFLNKAADFIEELSSLFKSHSSKRIRPRACKN
HKSKLESQNKVMQENSSSFSDLSERRERSSVPIPIPADTRDNEVNHALEQQEAKRREAEQ
AASEAAGGDTTPGSSPSSLYYEEPLGQPPRFTQKLRSREVPEGTRVQLDCIVVGIPPPQV
RWYCEGKELENSPDIHIVQAGNLHSLTIAEAFEEDTGRYSCFASNIYGTDSTSAEIYIEG
VSSSDSEGDPNKEEMNRIQKPNEVSSPPTTSAVIPPAVPQAQHLVAQPRVATIQQCQSPT
NYLQGLDGKPIIAAPVFTKMLQNLSASEGQLVVFECRVKGAPSPKVEWYREGTLIEDSPD
FRILQKKPRSMAEPEEICTLVIAEVFAEDSGCFTCTASNKYGTVSSIAQLHVRGNEDLSN
NGSLHSANSTTNLAAIEPQPSPPHSEPPSVEQPPKPKLEGVLVNHNEPRSSSRIGLRVHF
NLPEDDKGSEASSEAGVVTTRQTRPDSFQERFNGQATKTPEPSSPVKEPPPVLAKPKLDS
TQLQQLHNQVLLEQHQLQNPPPSSPKEFPFSMTVLNSNAPPAVTTSSKQVKAPSSQTFSL
ARPKYFFPSTNTTAATVAPSSSPVFTLSSTPQTIQRTVSKESLLVSHPSVQTKSPGGLSI
QNEPLPPGPTEPTPPPFTFSIPSGNQFQPRCVSPIPVSPTSRIQNPVAFLSSVLPSLPAI
PPTNAMGLPRSAPSMPSQGLAKKNTKSPQPVNDDNIRETKNAVIRDLGKKITFSDVRPNQ
QEYKISSFEQRLMNEIEFRLERTPVDESDDEIQHDEIPTGKCIAPIFDKRLKHFRVTEGS
PVTFTCKIVGIPVPKVYWFKDGKQISKRNEHCKMRREGDGTCSLHIESTTSDDDGNYTIM
AANPQGRISCSGHLMVQSLPIRSRLTSAGQSHRGRSRVQERDKEPLQERFFRPHFLQAPG
DMVAHEGRLCRLDCKVSGLPPPELTWLLNGQPVLPDASHKMLVRETGVHSLLIDPLTQRD
AGTYKCIATNKTGQNSFSLELSVVAKEVKKAPVILEKLQNCGVPEGHPVRLECRVIGMPP
PVFYWKKDNETIPCTRERISMHQDTTGYACLLIQPAKKSDAGWYTLSAKNEAGIVSCTAR
LDIYAQWHHQIPPPMSVRPSGSRYGSLTSKGLDIFSAFSSMESTMVYSCSSRSVVESDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5DTJ9	0.271	0.272	0.000	1315	0.876	0.879	Q5DTJ9.pdb.gz	MYPN_MOUSE Myopalladin OS=Mus musculus OX=10090 GN=Mypn PE=1 SV=2
2	AFDB:Q86TC9	1.000	1.000	0.000	1320	1.000	1.000	Q86TC9.pdb.gz	MYPN_HUMAN Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2
3	AFDB:Q3V1M1	0.086	0.055	2.620E-27	2594	0.179	0.091	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
4	AFDB:Q6WRI0	0.095	0.060	2.511E-25	2623	0.171	0.086	Q6WRI0.pdb.gz	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
5	AFDB:Q90X22	0.116	0.120	6.030E-24	1276	0.148	0.154	Q90X22.pdb.gz
6	AFDB:Q6WRH9	0.083	0.058	1.597E-23	2597	0.164	0.083	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
7	AFDB:O55005	0.087	0.073	2.082E-21	1651	0.115	0.092	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
8	AFDB:F1R2D2	0.087	0.075	6.136E-20	1687	0.114	0.089	F1R2D2.pdb.gz
9	PDB:6dldD	0.090	0.297	1.459E-19	269	0.046	0.227	6dldD.pdb.gz
10	PDB:5oj2B	0.121	0.188	9.281E-18	692	0.080	0.153	5oj2B.pdb.gz
11	AFDB:Q0E9F2	0.086	0.077	1.654E-15	1542	0.105	0.090	Q0E9F2.pdb.gz	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
12	PDB:6dlfA	0.073	0.327	8.487E-15	236	0.040	0.225	6dlfA.pdb.gz
13	AFDB:Q8TEP8	0.086	0.060	6.980E-14	2537	0.128	0.067	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
14	PDB:1e07A	0.080	0.133	7.309E-14	642	0.058	0.118	1e07A.pdb.gz
15	PDB:6feyB	0.073	0.407	8.600E-12	207	0.037	0.237	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
16	PDB:2rcjC	0.115	0.222	1.675E-11	523	0.038	0.096	2rcjC.pdb.gz
17	PDB:3o3uN	0.091	0.171	1.864E-10	580	0.030	0.069	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
18	PDB:5c6wJ	0.062	0.310	5.196E-10	238	0.023	0.130	5c6wJ.pdb.gz
19	PDB:1hzhH	0.069	0.179	9.132E-10	457	0.043	0.125	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
20	PDB:7sqcO0	0.081	0.090	2.183E-9	1140	0.036	0.041	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A7X7	0.0	2251	1298	0.867	0.882	D4A7X7_RAT Myopalladin OS=Rattus norvegicus OX=10116 GN=Mypn PE=1 SV=1
2	Q5DTJ9	0.0	2272	1315	0.869	0.872	MYPN_MOUSE Myopalladin OS=Mus musculus OX=10090 GN=Mypn PE=1 SV=2
3	Q86TC9	0.0	2714	1320	1.000	1.000	MYPN_HUMAN Myopalladin OS=Homo sapiens OX=9606 GN=MYPN PE=1 SV=2
4	Q8WX93	0.0	599	1383	0.223	0.213	PALLD_HUMAN Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3
5	Q9ET54	1.25e-180	574	1408	0.220	0.207	PALLD_MOUSE Palladin OS=Mus musculus OX=10090 GN=Palld PE=1 SV=2
6	P0C5E3	5.87e-173	528	603	0.190	0.416	PALLD_RAT Palladin (Fragment) OS=Rattus norvegicus OX=10116 GN=Palld PE=1 SV=1
7	B2RTX2	4.66e-171	540	1106	0.193	0.231	B2RTX2_HUMAN Palladin, cytoskeletal associated protein OS=Homo sapiens OX=9606 GN=PALLD PE=2 SV=1
8	Q9UBF9	4.87e-75	260	498	0.098	0.261	MYOTI_HUMAN Myotilin OS=Homo sapiens OX=9606 GN=MYOT PE=1 SV=2
9	Q9JIF9	6.44e-72	251	496	0.087	0.232	MYOTI_MOUSE Myotilin OS=Mus musculus OX=10090 GN=Myot PE=1 SV=1
10	E7FH53	3.27e-62	225	561	0.081	0.191	E7FH53_DANRE Myotilin OS=Danio rerio OX=7955 GN=myot PE=4 SV=2
11	O97791	1.45e-58	225	2000	0.111	0.073	O97791_RABIT Titin (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=titin PE=1 SV=1
12	A0A8I6A794	1.42e-57	223	5475	0.111	0.027	A0A8I6A794_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
13	Q8WZ42	5.89e-57	221	34350	0.111	0.004	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
14	A2ASS6	8.02e-57	220	35213	0.111	0.004	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
15	A0A8I5ZUN3	9.93e-57	220	35375	0.111	0.004	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
16	A0A8I5ZU83	1.47e-56	219	26931	0.111	0.005	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
17	Q9I7U4	1.22e-52	207	18141	0.098	0.007	TITIN_DROME Titin OS=Drosophila melanogaster OX=7227 GN=sls PE=1 SV=3
18	O01761	2.04e-31	137	8081	0.073	0.012	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
19	Q6PDN3	3.57e-30	132	1941	0.069	0.047	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
20	A8DYP0	3.40e-29	130	4218	0.068	0.021	OBSCN_DROME Obscurin OS=Drosophila melanogaster OX=7227 GN=Unc-89 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06832 BiPBP_C	17	16.9	Penicillin-Binding Protein C-terminus Family
2	PF07654 C1-set	0.0054	28.4	Immunoglobulin C1-set domain
3	PF05790 C2-set	1.6e+02	13.9	Immunoglobulin C2-set domain
4	PF08205 C2-set_2	2.3e-07	42.1	CD80-like C2-set immunoglobulin domain
5	PF07679 I-set	1.2e-103	350.7	Immunoglobulin I-set domain
6	PF00047 ig	4.8e-47	169.4	Immunoglobulin domain
7	PF13895 Ig_2	8.6e-44	159.1	Immunoglobulin domain
8	PF13927 Ig_3	9.8e-71	245.6	Immunoglobulin domain
9	PF17736 Ig_C17orf99	3.8e-06	38.2	C17orf99 Ig domain
10	PF16706 Izumo-Ig	2.8	19.2	Izumo-like Immunoglobulin domain
11	PF11465 Receptor_2B4	0.22	23.1	Natural killer cell receptor 2B4
12	PF07686 V-set	7.1e-15	66.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351790

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360762	0.984	Ankyrin repeat domain-containing protein 1
2	9606.ENSP00000484342	0.982	Nebulin
3	9606.ENSP00000366326	0.917	Nebulette
4	9606.ENSP00000443495	0.877	Alpha-actinin-2
5	9606.ENSP00000321679	0.769	Ankyrin repeat domain-containing protein 23
6	9606.ENSP00000312624	0.746	Telethonin
7	9606.ENSP00000401437	0.743	LIM domain-binding protein 3
8	9606.ENSP00000431813	0.711	Cysteine and glycine-rich protein 3
9	9606.ENSP00000378624	0.698	Probable E3 ubiquitin-protein ligase HERC4
10	9606.ENSP00000385684	0.672	Probable E3 ubiquitin-protein ligase HERC3
11	9606.ENSP00000306997	0.668	Myozenin-2
12	9606.ENSP00000351619	0.658	Phenazine biosynthesis like protein domain containing
13	9606.ENSP00000422007	0.656	Alpha-actinin-3
14	9606.ENSP00000212015	0.654	NAD-dependent protein deacetylase sirtuin-1
15	9606.ENSP00000256969	0.644	Spexin
16	9606.ENSP00000352272	0.644	Myozenin-1
17	9606.ENSP00000273968	0.642	Protein preY, mitochondrial
18	9606.ENSP00000380349	0.637	Calpain-3
19	9606.ENSP00000287777	0.634	Kelch-like protein 40
20	9606.ENSP00000414670	0.634	Leiomodin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017124	1.000	SH3 domain binding
GO:0051371	1.000	muscle alpha-actinin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0048856	0.957	anatomical structure development
GO:0016043	0.951	cellular component organization
GO:0030154	0.938	cell differentiation
GO:0055002	0.918	striated muscle cell development
GO:0009653	0.880	anatomical structure morphogenesis
GO:0030239	0.837	myofibril assembly
GO:0045214	0.751	sarcomere organization
GO:0032501	0.485	multicellular organismal process
GO:0065007	0.336	biological regulation
GO:0050789	0.306	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030017	0.998	sarcomere
GO:0030018	0.990	Z disc
GO:0043227	0.952	membrane-bounded organelle
GO:0043231	0.878	intracellular membrane-bounded organelle
GO:0005634	0.639	nucleus
GO:0005829	0.358	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]