StarFunc result for job id Q86TJ2

User Input

>input (420 residues)
MAELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFT
LWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHYVSMYIHGNLG
KACIPDTIPNRVTDHTCPSGGPLSPSLTTPLPPLDISVAEQQQLGYMPLRDDYEIEYDQD
AETLISGLSVNYDDDDVEIELKRAHVDMYVRKLKERQRRKNIARDYNLVPAFLGKDKKEK
EKALKRKITKEEKELRLKLRPLYQFMSCKEFDDLFENMHKEKMLRAKIRELQRYRRNGIT
KMEESAEYEAARHKREKRKENKNLAGSKRGKEDGKDSEFAAIENLPGFELLSDREKVLCS
SLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWISRDAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z4Z0	0.740	0.740	9.617E-65	420	0.993	0.993	D3Z4Z0.pdb.gz	D3Z4Z0_MOUSE Transcriptional adapter OS=Mus musculus OX=10090 GN=Tada2b PE=1 SV=1
2	AFDB:A0A0B4KFU2	0.391	0.392	1.089E-26	418	0.317	0.318	A0A0B4KFU2.pdb.gz	A0A0B4KFU2_DROME Transcriptional adapter OS=Drosophila melanogaster OX=7227 GN=Ada2b PE=4 SV=1
3	AFDB:Q8I8V0	0.367	0.292	7.884E-26	555	0.312	0.236	Q8I8V0.pdb.gz	TAD2B_DROME Transcriptional adapter 2B OS=Drosophila melanogaster OX=7227 GN=Ada2b PE=1 SV=1
4	AFDB:Q02336	0.348	0.339	7.829E-23	434	0.293	0.283	Q02336.pdb.gz	ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADA2 PE=1 SV=1
5	AFDB:A0A024R0Y4	0.312	0.298	1.488E-22	443	0.295	0.280	A0A024R0Y4.pdb.gz	A0A024R0Y4_HUMAN Transcriptional adapter OS=Homo sapiens OX=9606 GN=TADA2A PE=1 SV=1
6	AFDB:Q6FMQ2	0.269	0.257	1.652E-21	445	0.271	0.256	Q6FMQ2.pdb.gz	Q6FMQ2_CANGA Transcriptional adapter 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ADA2 PE=4 SV=1
7	AFDB:Q59WH0	0.309	0.295	2.673E-21	445	0.286	0.270	Q59WH0.pdb.gz	ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ADA2 PE=3 SV=2
8	AFDB:Q9P7J7	0.311	0.303	6.291E-21	437	0.248	0.238	Q9P7J7.pdb.gz	ADA2_SCHPO Transcriptional adapter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ada2 PE=1 SV=1
9	AFDB:Q54VX6	0.260	0.141	2.041E-20	914	0.310	0.142	Q54VX6.pdb.gz	Q54VX6_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280079 PE=4 SV=1
10	AFDB:Q9ATB4	0.260	0.229	2.968E-20	487	0.281	0.242	Q9ATB4.pdb.gz	TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana OX=3702 GN=ADA2B PE=1 SV=1
11	PDB:6k15H	0.135	0.141	2.369E-4	393	0.112	0.120	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
12	PDB:6tdaL	0.126	0.099	1.179E-3	596	0.145	0.102	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
13	PDB:7dd9A	0.107	0.041	2.229E-1	1129	0.033	0.012	7dd9A.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
14	PDB:7ddeA	0.110	0.089	2.481E-1	525	0.036	0.029	7ddeA.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
15	PDB:6lthO	0.115	0.146	4.236E-1	325	0.112	0.145	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
16	PDB:7c4jB	0.120	0.127	4.714E-1	395	0.107	0.114	7c4jB.pdb.gz
17	PDB:6exnO	0.106	0.138	6.499E-1	320	0.126	0.166	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
18	PDB:3jb9W	0.097	0.095	7.630E-1	426	0.090	0.089	3jb9W.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
19	PDB:7dcoL	0.106	0.102	8.958E-1	435	0.121	0.117	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
20	PDB:4nmnA	0.102	0.101	2.224	425	0.121	0.120	4nmnA.pdb.gz	Nucleotide and partner-protein control of bacterial replicative helicase structure and function.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YW26	0.0	670	345	0.779	0.948	D3YW26_MOUSE Transcriptional adaptor 2B OS=Mus musculus OX=10090 GN=Tada2b PE=1 SV=1
2	D3Z4Z0	0.0	867	420	0.993	0.993	D3Z4Z0_MOUSE Transcriptional adapter OS=Mus musculus OX=10090 GN=Tada2b PE=1 SV=1
3	Q86TJ2	0.0	872	420	1.000	1.000	TAD2B_HUMAN Transcriptional adapter 2-beta OS=Homo sapiens OX=9606 GN=TADA2B PE=1 SV=2
4	A0A0B4KFU2	3.79e-78	249	418	0.319	0.321	A0A0B4KFU2_DROME Transcriptional adapter OS=Drosophila melanogaster OX=7227 GN=Ada2b PE=4 SV=1
5	Q8I8V0	3.13e-76	249	555	0.319	0.241	TAD2B_DROME Transcriptional adapter 2B OS=Drosophila melanogaster OX=7227 GN=Ada2b PE=1 SV=1
6	Q02336	2.00e-48	172	434	0.300	0.290	ADA2_YEAST Transcriptional adapter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADA2 PE=1 SV=1
7	Q59WH0	1.91e-43	159	445	0.295	0.279	ADA2_CANAL Transcriptional adapter 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ADA2 PE=3 SV=2
8	Q6FMQ2	1.69e-42	157	445	0.279	0.263	Q6FMQ2_CANGA Transcriptional adapter 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=ADA2 PE=4 SV=1
9	A0A024R0Y4	1.95e-40	151	443	0.286	0.271	A0A024R0Y4_HUMAN Transcriptional adapter OS=Homo sapiens OX=9606 GN=TADA2A PE=1 SV=1
10	Q8CHV6	2.23e-40	151	443	0.286	0.271	TAD2A_MOUSE Transcriptional adapter 2-alpha OS=Mus musculus OX=10090 GN=Tada2a PE=1 SV=1
11	O75478	2.27e-40	151	443	0.286	0.271	TAD2A_HUMAN Transcriptional adapter 2-alpha OS=Homo sapiens OX=9606 GN=TADA2A PE=1 SV=3
12	Q9P7J7	1.05e-38	146	437	0.283	0.272	ADA2_SCHPO Transcriptional adapter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ada2 PE=1 SV=1
13	Q9ATB4	1.28e-38	147	487	0.302	0.261	TAD2B_ARATH Transcriptional adapter ADA2b OS=Arabidopsis thaliana OX=3702 GN=ADA2B PE=1 SV=1
14	Q8IJP9	1.52e-34	139	2578	0.283	0.046	Q8IJP9_PLAF7 Transcriptional coactivator ADA2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1014600 PE=4 SV=1
15	Q54VX6	1.01e-33	136	914	0.248	0.114	Q54VX6_DICDI Myb domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0280079 PE=4 SV=1
16	C8V3C2	8.72e-33	131	517	0.245	0.199	C8V3C2_EMENI Transcriptional adapter 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10763 PE=4 SV=1
17	E1JIP2	1.01e-28	120	527	0.283	0.226	E1JIP2_DROME Transcriptional adapter OS=Drosophila melanogaster OX=7227 GN=Ada2a PE=4 SV=1
18	Q7KSD8	2.65e-27	116	562	0.286	0.214	TAD2A_DROME Transcriptional adapter 2A OS=Drosophila melanogaster OX=7227 GN=Ada2a PE=1 SV=1
19	Q9SFD5	8.92e-23	102	548	0.117	0.089	TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidopsis thaliana OX=3702 GN=ADA2A PE=1 SV=1
20	Q75LL6	9.68e-23	102	567	0.107	0.079	TADA2_ORYSJ Transcriptional adapter ADA2 OS=Oryza sativa subsp. japonica OX=39947 GN=ADA2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00249 Myb_DNA-binding	1.1e-06	40.1	Myb-like DNA-binding domain
2	PF13921 Myb_DNA-bind_6	0.027	26.0	Myb-like DNA-binding domain
3	PF04433 SWIRM	2e+02	13.8	SWIRM domain
4	PF00643 zf-B_box	13	17.4	B-box zinc finger
5	PF00569 ZZ	0.37	22.0	Zinc finger, ZZ type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308022

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307684	0.999	Transcriptional adapter 3
2	9606.ENSP00000360515	0.999	Transcription initiation protein SPT3 homolog
3	9606.ENSP00000225916	0.998	Histone acetyltransferase KAT2A
4	9606.ENSP00000316114	0.998	SAGA-associated factor 29
5	9606.ENSP00000417510	0.998	SPT20 homolog, SAGA complex component
6	9606.ENSP00000397259	0.997	Ataxin-7-like protein 3
7	9606.ENSP00000263974	0.996	Transcription initiation factor TFIID subunit 12
8	9606.ENSP00000352925	0.996	Transformation/transcription domain-associated protein
9	9606.ENSP00000263754	0.995	Histone acetyltransferase KAT2B
10	9606.ENSP00000299424	0.995	Transcription initiation factor TFIID subunit 10
11	9606.ENSP00000336750	0.993	SPT7 like, STAGA complex gamma subunit
12	9606.ENSP00000258281	0.990	TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L
13	9606.ENSP00000356848	0.990	Transcriptional adapter 1
14	9606.ENSP00000339917	0.988	Transcription initiation factor TFIID subunit 9B
15	9606.ENSP00000294168	0.987	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L
16	9606.ENSP00000439585	0.984	Ataxin-7
17	9606.ENSP00000370193	0.982	Transcription initiation factor TFIID subunit 9
18	9606.ENSP00000429986	0.978	Transcription and mRNA export factor ENY2
19	9606.ENSP00000261497	0.972	Ubiquitin carboxyl-terminal hydrolase 22
20	9606.ENSP00000306983	0.970	YEATS domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.504	transcription regulator activity
GO:0003712	0.439	transcription coregulator activity
GO:0003676	0.418	nucleic acid binding
GO:0003677	0.407	DNA binding
GO:0003713	0.402	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019538	0.995	protein metabolic process
GO:0016579	0.986	protein deubiquitination
GO:0016570	0.976	histone modification
GO:0009987	0.870	cellular process
GO:0050794	0.856	regulation of cellular process
GO:0016578	0.828	histone deubiquitination
GO:0051171	0.787	regulation of nitrogen compound metabolic process
GO:0060255	0.767	regulation of macromolecule metabolic process
GO:0080090	0.765	regulation of primary metabolic process
GO:0010556	0.644	regulation of macromolecule biosynthetic process
GO:0031323	0.638	regulation of cellular metabolic process
GO:0019219	0.633	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.615	regulation of DNA-templated transcription
GO:0006357	0.542	regulation of transcription by RNA polymerase II
GO:0018205	0.535	peptidyl-lysine modification
GO:0048518	0.469	positive regulation of biological process
GO:0043543	0.469	protein acylation
GO:0006473	0.451	protein acetylation
GO:0048522	0.420	positive regulation of cellular process
GO:0016573	0.420	histone acetylation
GO:0044237	0.416	cellular metabolic process
GO:0071840	0.329	cellular component organization or biogenesis
GO:0016043	0.321	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070461	0.999	SAGA-type complex
GO:0005654	0.986	nucleoplasm
GO:0000124	0.709	SAGA complex
GO:0005737	0.683	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]