StarFunc result for job id Q86TL2

User Input

>input (294 residues)
MQGPAGNASRGLPGGPPSTVASGAGRCESGALMHSFGIFLQGLLGVVAFSTLMLKRFREP
KHERRPWRIWFLDTSKQAIGMLFIHFANVYLADLTEEDPCSLYLINFLLDATVGMLLIYV
GVRAVSVLVEWQQWESLRFGEYGDPLQCGAWVGQCALYIVIMIFEKSVVFIVLLILQWKK
VALLNPIENPDLKLAIVMLIVPFFVNALMFWVVDNFLMRKGKTKAKLEERGANQDSRNGS
KVRYRRAASHEESESEILISADDEMEESDVEEDLRRLTPLKPVKKKKHRFGLPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86TL2	1.000	1.000	6.556E-40	294	1.000	1.000	Q86TL2.pdb.gz	STIMA_HUMAN Store-operated calcium entry regulator STIMATE OS=Homo sapiens OX=9606 GN=STIMATE PE=1 SV=1
2	AFDB:Q9BZJ8	0.195	0.149	5.459E-2	451	0.156	0.102	Q9BZJ8.pdb.gz	GPR61_HUMAN G-protein coupled receptor 61 OS=Homo sapiens OX=9606 GN=GPR61 PE=1 SV=2
3	AFDB:P30729	0.230	0.188	6.342E-2	387	0.163	0.124	P30729.pdb.gz	DRD4_RAT D(4) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd4 PE=1 SV=2
4	AFDB:P21917	0.237	0.185	1.099E-1	419	0.143	0.100	P21917.pdb.gz	DRD4_HUMAN D(4) dopamine receptor OS=Homo sapiens OX=9606 GN=DRD4 PE=1 SV=3
5	AFDB:D6VTK4	0.190	0.146	1.155E-1	431	0.153	0.104	D6VTK4.pdb.gz	STE2_YEAST Pheromone alpha factor receptor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STE2 PE=1 SV=2
6	AFDB:Q09388	0.163	0.103	1.410E-1	627	0.143	0.067	Q09388.pdb.gz	ACM2_CAEEL Muscarinic acetylcholine receptor gar-2 OS=Caenorhabditis elegans OX=6239 GN=gar-2 PE=2 SV=3
7	AFDB:Q8N4S9	0.145	0.091	1.638E-1	558	0.136	0.072	Q8N4S9.pdb.gz	MALD2_HUMAN MARVEL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MARVELD2 PE=1 SV=2
8	AFDB:P35375	0.220	0.180	1.722E-1	405	0.170	0.123	P35375.pdb.gz	PE2R1_MOUSE Prostaglandin E2 receptor EP1 subtype OS=Mus musculus OX=10090 GN=Ptger1 PE=2 SV=1
9	AFDB:M9YY17	0.167	0.102	2.211E-1	569	0.143	0.074	M9YY17.pdb.gz	M9YY17_ONCMY Tricellulin (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
10	AFDB:Q4LBB6	0.188	0.063	2.211E-1	1256	0.143	0.033	Q4LBB6.pdb.gz	OCTB3_DROME Octopamine receptor beta-3R OS=Drosophila melanogaster OX=7227 GN=Octbeta3R PE=2 SV=4
11	PDB:6g79S	0.221	0.238	7.528E-1	262	0.085	0.095	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.
12	PDB:7cz5R	0.198	0.204	9.192E-1	269	0.095	0.104	7cz5R.pdb.gz	Structural basis for activation of the growth hormone-releasing hormone receptor.
13	PDB:6li3R	0.234	0.240	1.016	284	0.102	0.106	6li3R.pdb.gz
14	PDB:7lciR	0.183	0.151	1.016	393	0.126	0.094	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
15	PDB:7f8xA	0.149	0.111	1.180	443	0.088	0.059	7f8xA.pdb.gz	Structures of the human cholecystokinin receptors bound to agonists and antagonists.
16	PDB:7jvqR	0.189	0.193	1.240	286	0.092	0.094	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
17	PDB:7xtcR	0.152	0.161	1.240	275	0.092	0.098	7xtcR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
18	PDB:7nsgA	0.141	0.109	1.304	430	0.095	0.065	7nsgA.pdb.gz	Structure of human excitatory amino acid transporter 3 (EAAT3) in complex with HIP-B
19	PDB:6wpwR	0.227	0.180	1.674	398	0.085	0.063	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
20	PDB:6iblA	0.189	0.153	1.850	397	0.102	0.076	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86TL2	0.0	603	294	1.000	1.000	STIMA_HUMAN Store-operated calcium entry regulator STIMATE OS=Homo sapiens OX=9606 GN=STIMATE PE=1 SV=1
2	Q12042	7.00e-17	80.9	273	0.211	0.227	YP162_YEAST Vacuolar membrane protein YPL162C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPL162C PE=1 SV=1
3	Q57XZ9	0.70	33.9	853	0.065	0.022	Q57XZ9_TRYB2 Cytoskeleton-associated protein CAP5.5, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.740 PE=4 SV=1
4	Q04322	2.7	32.0	720	0.075	0.031	GYL1_YEAST Probable GTPase-activating protein GYL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GYL1 PE=1 SV=1
5	Q57WJ7	2.8	32.0	888	0.061	0.020	Q57WJ7_TRYB2 Calpain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28A12.350 PE=4 SV=1
6	Q8I492	4.7	31.6	1434	0.065	0.013	Q8I492_PLAF7 Mature parasite-infected erythrocyte surface antigen OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0500800 PE=4 SV=1
7	P14785	5.0	31.2	491	0.102	0.061	CCNA_DROME G2/mitotic-specific cyclin-A OS=Drosophila melanogaster OX=7227 GN=CycA PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15883 DUF4736	6e+02	11.5	Domain of unknown function (DUF4736)
2	PF12400 STIMATE	1.5e-29	114.4	STIMATE family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000422941

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256255	0.853	Store-operated calcium entry-associated regulatory factor
2	9606.ENSP00000478059	0.771	Stromal interaction molecule 1
3	9606.ENSP00000400932	0.690	Solute carrier family 35 member G1
4	9606.ENSP00000409382	0.660	EF-hand calcium-binding domain-containing protein 4B
5	9606.ENSP00000267113	0.622	Extended synaptotagmin-1
6	9606.ENSP00000480616	0.612	Calcium release-activated calcium channel protein 1
7	9606.ENSP00000377724	0.587	ORM1-like protein 3
8	9606.ENSP00000406933	0.541	5'-nucleotidase domain containing 2
9	9606.ENSP00000380958	0.540	Myelin basic protein
10	9606.ENSP00000251527	0.531	Extended synaptotagmin-2
11	9606.ENSP00000368767	0.519	Aspartyl/asparaginyl beta-hydroxylase
12	9606.ENSP00000267838	0.513	LysM and putative peptidoglycan-binding domain-containing protein 2
13	9606.ENSP00000263354	0.508	Alpha-soluble NSF attachment protein
14	9606.ENSP00000374218	0.506	Extended synaptotagmin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005246	1.000	calcium channel regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0051049	0.975	regulation of transport
GO:0051924	0.958	regulation of calcium ion transport
GO:0043270	0.945	positive regulation of monoatomic ion transport
GO:0048522	0.936	positive regulation of cellular process
GO:1904062	0.911	regulation of monoatomic cation transmembrane transport
GO:0050896	0.910	response to stimulus
GO:0032412	0.903	regulation of monoatomic ion transmembrane transporter activity
GO:0034764	0.898	positive regulation of transmembrane transport
GO:0023052	0.889	signaling
GO:0007154	0.888	cell communication
GO:0051928	0.884	positive regulation of calcium ion transport
GO:0044093	0.872	positive regulation of molecular function
GO:1903169	0.864	regulation of calcium ion transmembrane transport
GO:1904064	0.844	positive regulation of cation transmembrane transport
GO:0035556	0.835	intracellular signal transduction
GO:2001257	0.805	regulation of cation channel activity
GO:1902531	0.796	regulation of intracellular signal transduction
GO:0023056	0.785	positive regulation of signaling
GO:0010647	0.785	positive regulation of cell communication
GO:0032414	0.777	positive regulation of ion transmembrane transporter activity
GO:1904427	0.776	positive regulation of calcium ion transmembrane transport
GO:0019932	0.770	second-messenger-mediated signaling
GO:1901019	0.768	regulation of calcium ion transmembrane transporter activity
GO:2001259	0.745	positive regulation of cation channel activity
GO:0050848	0.725	regulation of calcium-mediated signaling
GO:1901021	0.721	positive regulation of calcium ion transmembrane transporter activity
GO:1902533	0.695	positive regulation of intracellular signal transduction
GO:0106056	0.687	regulation of calcineurin-mediated signaling
GO:0019722	0.685	calcium-mediated signaling
GO:0050850	0.584	positive regulation of calcium-mediated signaling
GO:0070884	0.568	regulation of calcineurin-NFAT signaling cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0044232	0.995	organelle membrane contact site
GO:0032541	0.995	cortical endoplasmic reticulum
GO:0140268	0.722	endoplasmic reticulum-plasma membrane contact site
GO:0005886	0.484	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]