StarFunc result for job id Q86TM6

User Input

>input (617 residues)
MFRTAVMMAASLALTGAVVAHAYYLKHQFYPTVVYLTKSSPSMAVLYIQAFVLVFLLGKV
MGKVFFGQLRAAEMEHLLERSWYAVTETCLAFTVFRDDFSPRFVALFTLLLFLKCFHWLA
EDRVDFMERSPNISWLFHCRIVSLMFLLGILDFLFVSHAYHSILTRGASVQLVFGFEYAI
LMTMVLTIFIKYVLHSVDLQSENPWDNKAVYMLYTELFTGFIKVLLYMAFMTIMIKVHTF
PLFAIRPMYLAMRQFKKAVTDAIMSRRAIRNMNTLYPDATPEELQAMDNVCIICREEMVT
GAKRLPCNHIFHTSCLRSWFQRQQTCPTCRMDVLRASLPAQSPPPPEPADQGPPPAPHPP
PLLPQPPNFPQGLLPPFPPGMFPLWPPMGPFPPVPPPPSSGEAVAPPSTSAAALSRPSGA
ATTTAAGTSATAASATASGPGSGSAPEAGPAPGFPFPPPWMGMPLPPPFAFPPMPVPPAG
FAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSV
NSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGTEEMPEDGEPDA
AELRRRRLQKLESPVAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86TM6	0.999	0.999	2.082E-74	617	1.000	1.000	Q86TM6.pdb.gz	SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2
2	AFDB:Q95SP2	0.550	0.542	2.839E-42	626	0.472	0.465	Q95SP2.pdb.gz	HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster OX=7227 GN=sip3 PE=1 SV=1
3	AFDB:Q20798	0.615	0.622	1.862E-38	610	0.428	0.433	Q20798.pdb.gz	HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans OX=6239 GN=sel-11 PE=3 SV=1
4	AFDB:Q9LW77	0.544	0.677	2.745E-24	492	0.280	0.352	Q9LW77.pdb.gz	HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana OX=3702 GN=HRD1A PE=2 SV=1
5	AFDB:Q6NPT7	0.525	0.697	1.620E-23	460	0.233	0.313	Q6NPT7.pdb.gz	HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana OX=3702 GN=HRD1B PE=2 SV=1
6	AFDB:O74757	0.517	0.473	5.646E-22	677	0.264	0.241	O74757.pdb.gz	HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrd1 PE=1 SV=1
7	AFDB:Q38F27	0.498	0.623	2.223E-14	488	0.126	0.160	Q38F27.pdb.gz	Q38F27_TRYB2 RING-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3780 PE=4 SV=1
8	AFDB:F6P980	0.162	0.094	1.524E-2	1241	0.122	0.060	F6P980.pdb.gz
9	AFDB:Q68DV7	0.114	0.093	2.079E-2	783	0.133	0.105	Q68DV7.pdb.gz	RNF43_HUMAN E3 ubiquitin-protein ligase RNF43 OS=Homo sapiens OX=9606 GN=RNF43 PE=1 SV=1
10	AFDB:O94452	0.086	0.081	5.051E-2	661	0.105	0.098	O94452.pdb.gz	MCP1_SCHPO Meiotic coiled-coil protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcp1 PE=4 SV=1
11	PDB:6hu9c	0.126	0.227	8.172E-1	269	0.065	0.149	6hu9c.pdb.gz	Structure of yeast cytochrome c oxidase in a supercomplex with cytochrome bc1.
12	PDB:6y7fB	0.135	0.289	9.759E-1	256	0.042	0.102	6y7fB.pdb.gz	Crystal structure of human ELOVL fatty acid elongase 7 (ELOVL7)
13	PDB:5gm6a	0.079	0.366	1.020	123	0.019	0.098	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:7dxbA	0.129	0.114	1.115	738	0.071	0.060	7dxbA.pdb.gz	Structural mechanism of human TRPC3 and TRPC6 channel regulation by their intracellular calcium-binding sites.
15	PDB:7tbhA	0.097	0.227	1.166	243	0.044	0.111	7tbhA.pdb.gz	Cryo-EM, Protein Engineering, and Simulation Enable the Development of Peptide Therapeutics against Acute Myeloid Leukemia.
16	PDB:7wwbA	0.100	0.151	1.392	333	0.050	0.093	7wwbA.pdb.gz	Rational exploration of fold atlas for human solute carrier proteins.
17	PDB:3c98B	0.132	0.299	1.521	230	0.045	0.122	3c98B.pdb.gz
18	PDB:7ew2R	0.149	0.230	1.662	290	0.047	0.100	7ew2R.pdb.gz	Structural insights into sphingosine-1-phosphate recognition and ligand selectivity of S1PR3-Gi signaling complexes.
19	PDB:1occC	0.094	0.182	1.985	261	0.049	0.115	1occC.pdb.gz	The whole structure of the 13-subunit oxidized cytochrome c oxidase at 2.8 A.
20	PDB:2gs4A	0.126	0.362	1.985	159	0.034	0.132	2gs4A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86TM6	0.0	1248	617	1.000	1.000	SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens OX=9606 GN=SYVN1 PE=1 SV=2
2	Q95SP2	0.0	550	626	0.481	0.474	HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster OX=7227 GN=sip3 PE=1 SV=1
3	Q9DBY1	0.0	1000	612	0.938	0.946	SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus OX=10090 GN=Syvn1 PE=1 SV=3
4	Q20798	1.85e-131	400	610	0.332	0.336	HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans OX=6239 GN=sel-11 PE=3 SV=1
5	Q9LW77	5.35e-91	291	492	0.248	0.311	HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana OX=3702 GN=HRD1A PE=2 SV=1
6	Q6NPT7	4.70e-90	288	460	0.235	0.315	HRD1B_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1B OS=Arabidopsis thaliana OX=3702 GN=HRD1B PE=2 SV=1
7	Q4WCD2	2.62e-63	224	771	0.222	0.178	Q4WCD2_ASPFU RING finger protein OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G04840 PE=4 SV=1
8	O74757	2.53e-46	176	677	0.233	0.213	HRD1_SCHPO ERAD-associated E3 ubiquitin-protein ligase hrd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hrd1 PE=1 SV=1
9	F1QB30	4.84e-32	133	620	0.151	0.150	F1QB30_DANRE Autocrine motility factor receptor a OS=Danio rerio OX=7955 GN=amfr PE=4 SV=1
10	Q6PFU8	4.84e-32	133	620	0.151	0.150	Q6PFU8_DANRE Autocrine motility factor receptor OS=Danio rerio OX=7955 GN=amfr PE=2 SV=1
11	Q8ILM8	7.53e-32	131	510	0.165	0.200	Q8ILM8_PLAF7 ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1422500 PE=4 SV=2
12	Q9R049	8.72e-30	127	643	0.156	0.149	AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus OX=10090 GN=Amfr PE=1 SV=2
13	A0A0G2K437	1.11e-29	127	770	0.154	0.123	A0A0G2K437_RAT Autocrine motility factor receptor OS=Rattus norvegicus OX=10116 GN=Amfr PE=1 SV=2
14	Q9UKV5	1.57e-29	126	643	0.152	0.146	AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2
15	Q8VYC8	5.38e-22	102	578	0.164	0.175	RIN2_ARATH E3 ubiquitin protein ligase RIN2 OS=Arabidopsis thaliana OX=3702 GN=RIN2 PE=1 SV=1
16	Q8W4Q5	1.24e-19	95.1	577	0.206	0.220	RIN3_ARATH E3 ubiquitin protein ligase RIN3 OS=Arabidopsis thaliana OX=3702 GN=RIN3 PE=1 SV=2
17	F4KD92	2.98e-19	94.0	595	0.209	0.217	F4KD92_ARATH RPM1 interacting protein 3 OS=Arabidopsis thaliana OX=3702 GN=RIN3 PE=1 SV=1
18	Q7KRW1	3.67e-13	75.1	809	0.073	0.056	TRC8_DROME Protein TRC8 homolog OS=Drosophila melanogaster OX=7227 GN=Trc8 PE=1 SV=1
19	Q8WU17	6.48e-13	73.9	664	0.052	0.048	RN139_HUMAN E3 ubiquitin-protein ligase RNF139 OS=Homo sapiens OX=9606 GN=RNF139 PE=1 SV=1
20	Q08109	1.36e-12	72.8	551	0.066	0.074	HRD1_YEAST ERAD-associated E3 ubiquitin-protein ligase HRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HRD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02945 Endonuclease_7	9.5e+02	11.1	Recombination endonuclease VII
2	PF11793 FANCL_C	7.8e+02	11.7	FANCL C-terminal domain
3	PF14447 Prok-RING_4	21	16.4	Prokaryotic RING finger family 4
4	PF12906 RINGv	8.3e+02	11.5	RING-variant domain
5	PF12861 zf-ANAPC11	89	14.6	Anaphase-promoting complex subunit 11 RING-H2 finger
6	PF17122 zf-C3H2C3	6.6e+02	11.8	Zinc-finger
7	PF00097 zf-C3HC4	0.00035	31.7	Zinc finger, C3HC4 type (RING finger)
8	PF13923 zf-C3HC4_2	0.0015	29.6	Zinc finger, C3HC4 type (RING finger)
9	PF13920 zf-C3HC4_3	0.087	24.0	Zinc finger, C3HC4 type (RING finger)
10	PF13771 zf-HC5HC2H	6.5e+02	12.0	PHD-like zinc-binding domain
11	PF12678 zf-rbx1	0.00026	32.5	RING-H2 zinc finger domain
12	PF08746 zf-RING-like	4.9e+02	12.3	RING-like domain
13	PF17123 zf-RING_11	0.6	21.2	RING-like zinc finger
14	PF16744 zf-RING_15	1.3e+02	14.1	KIAA1045 RING finger
15	PF17120 zf-RING_16	0.13	23.2	RING/Ubox like zinc-binding domain
16	PF13639 zf-RING_2	4.8e-07	41.4	Ring finger domain
17	PF14634 zf-RING_5	0.25	22.7	zinc-RING finger domain
18	PF13445 zf-RING_UBOX	0.034	25.5	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366395

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259512	0.999	Derlin-1
2	9606.ENSP00000318165	0.999	Protein OS-9
3	9606.ENSP00000337053	0.999	Protein sel-1 homolog 1
4	9606.ENSP00000351777	0.999	Transitional endoplasmic reticulum ATPase
5	9606.ENSP00000158771	0.998	Derlin-2
6	9606.ENSP00000185150	0.997	Endoplasmic reticulum lectin 1
7	9606.ENSP00000274140	0.985	E3 ubiquitin-protein ligase MARCH6
8	9606.ENSP00000384744	0.979	Derlin-3
9	9606.ENSP00000401445	0.976	Serine/threonine-protein kinase/endoribonuclease IRE1
10	9606.ENSP00000409555	0.968	Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein
11	9606.ENSP00000338348	0.967	Ubiquitin-conjugating enzyme E2 G2
12	9606.ENSP00000366748	0.965	AUP1, lipid droplet regulating VLDL assembly factor
13	9606.ENSP00000216037	0.962	X-box-binding protein 1
14	9606.ENSP00000367312	0.952	Protein sel-1 homolog 2
15	9606.ENSP00000381282	0.952	Selenoprotein S
16	9606.ENSP00000451261	0.950	Ubiquitin-conjugating enzyme E2 J1
17	9606.ENSP00000243253	0.944	Protein transport protein Sec61 subunit alpha isoform 1
18	9606.ENSP00000324173	0.944	78 kDa glucose-regulated protein
19	9606.ENSP00000261942	0.943	FAS-associated factor 2
20	9606.ENSP00000290649	0.937	E3 ubiquitin-protein ligase AMFR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0019899	0.965	enzyme binding
GO:0051087	0.886	chaperone binding
GO:0051117	0.883	ATPase binding
GO:0051082	0.877	unfolded protein binding
GO:1990381	0.875	ubiquitin-specific protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0065007	0.995	biological regulation
GO:0050896	0.995	response to stimulus
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0019538	0.994	protein metabolic process
GO:0051716	0.992	cellular response to stimulus
GO:0006950	0.986	response to stress
GO:0044260	0.985	cellular macromolecule metabolic process
GO:0006511	0.982	ubiquitin-dependent protein catabolic process
GO:0010498	0.980	proteasomal protein catabolic process
GO:0033554	0.965	cellular response to stress
GO:0010033	0.961	response to organic substance
GO:1905897	0.950	regulation of response to endoplasmic reticulum stress
GO:0048523	0.943	negative regulation of cellular process
GO:0031647	0.942	regulation of protein stability
GO:2001242	0.941	regulation of intrinsic apoptotic signaling pathway
GO:1903573	0.932	negative regulation of response to endoplasmic reticulum stress
GO:0036503	0.926	ERAD pathway
GO:0043161	0.923	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0023057	0.908	negative regulation of signaling
GO:0010648	0.908	negative regulation of cell communication
GO:0036211	0.902	protein modification process
GO:0009968	0.859	negative regulation of signal transduction
GO:0043066	0.832	negative regulation of apoptotic process
GO:0051179	0.810	localization
GO:1902532	0.804	negative regulation of intracellular signal transduction
GO:2001234	0.792	negative regulation of apoptotic signaling pathway
GO:2001243	0.746	negative regulation of intrinsic apoptotic signaling pathway
GO:0030433	0.729	ubiquitin-dependent ERAD pathway
GO:0050821	0.678	protein stabilization
GO:0051234	0.520	establishment of localization
GO:0033036	0.517	macromolecule localization
GO:0006810	0.514	transport
GO:0051641	0.466	cellular localization
GO:0045184	0.433	establishment of protein localization
GO:0046907	0.367	intracellular transport
GO:0048518	0.348	positive regulation of biological process
GO:0071702	0.341	organic substance transport
GO:0070647	0.314	protein modification by small protein conjugation or removal
GO:0015031	0.311	protein transport
GO:0009100	0.311	glycoprotein metabolic process
GO:0019222	0.307	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0005654	0.998	nucleoplasm
GO:0032991	0.993	protein-containing complex
GO:0016020	0.991	membrane
GO:0031090	0.965	organelle membrane
GO:0031984	0.948	organelle subcompartment
GO:0005789	0.934	endoplasmic reticulum membrane
GO:0098796	0.767	membrane protein complex
GO:1990234	0.747	transferase complex
GO:0140535	0.729	intracellular protein-containing complex
GO:0044322	0.728	endoplasmic reticulum quality control compartment
GO:0000151	0.719	ubiquitin ligase complex
GO:0140534	0.686	endoplasmic reticulum protein-containing complex
GO:0036513	0.499	Derlin-1 retrotranslocation complex
GO:0000835	0.445	ER ubiquitin ligase complex
GO:0000836	0.441	Hrd1p ubiquitin ligase complex
GO:0000839	0.431	Hrd1p ubiquitin ligase ERAD-L complex
GO:0005829	0.411	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]