StarFunc result for job id Q86TP1

User Input

>input (453 residues)
MEDYLQGCRAALQESRPLHVVLGNEACDLDSTVSALALAFYLAKTTEAEEVFVPVLNIKR
SELPLRGDIVFFLQKVHIPESILIFRDEIDLHALYQAGQLTLILVDHHILSKSDTALEEA
VAEVLDHRPIEPKHCPPCHVSVELVGSCATLVTERILQGAPEILDRQTAALLHGTIILDC
VNMDLKIGKATPKDSKYVEKLEALFPDLPKRNDIFDSLQKAKFDVSGLTTEQMLRKDQKT
IYRQGVKVAISAIYMDLEAFLQRSNLLADLHAFCQAHSYDVLVAMTIFFNTHNEPVRQLA
IFCPHVALQTTICEVLERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALS
AYFDSMKIPSGQPETADVSREQVDKELDRASNSLISGLSQDEEDPPLPPTPMNSLVDECP
LDQGLPKLSAEAVFEKCSQISLSQSTTASLSKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86TP1	1.000	1.000	6.448E-85	453	1.000	1.000	Q86TP1.pdb.gz	PRUN1_HUMAN Exopolyphosphatase PRUNE1 OS=Homo sapiens OX=9606 GN=PRUNE1 PE=1 SV=2
2	AFDB:A0A3B3ITN0	0.674	0.673	1.675E-64	454	0.918	0.916	A0A3B3ITN0.pdb.gz	A0A3B3ITN0_HUMAN Prune exopolyphosphatase 1 OS=Homo sapiens OX=9606 GN=PRUNE1 PE=1 SV=1
3	AFDB:O18399	0.677	0.750	3.472E-33	405	0.272	0.304	O18399.pdb.gz	O18399_DROME EG:152A3.5 protein (Fbgn0003116;pn protein) OS=Drosophila melanogaster OX=7227 GN=pn PE=1 SV=1
4	AFDB:O14094	0.579	0.663	1.545E-28	384	0.205	0.242	O14094.pdb.gz	PPX1_SCHPO Putative exopolyphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2F3.11 PE=3 SV=1
5	AFDB:P38698	0.532	0.590	2.876E-27	397	0.203	0.232	P38698.pdb.gz	PPX1_YEAST Polyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PPX1 PE=1 SV=1
6	PDB:2qb6A	0.537	0.602	2.599E-26	393	0.210	0.242	2qb6A.pdb.gz	The crystal structure of the cytosolic exopolyphosphatase from Saccharomyces cerevisiae reveals the basis for substrate specificity.
7	AFDB:Q38FJ8	0.669	0.782	2.248E-25	383	0.223	0.264	Q38FJ8.pdb.gz	Q38FJ8_TRYB2 Acidocalcisomal exopolyphosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1950 PE=4 SV=1
8	AFDB:Q24465	0.522	0.576	5.595E-23	404	0.232	0.260	Q24465.pdb.gz	Q24465_DROME Mutant prune OS=Drosophila melanogaster OX=7227 GN=pn PE=3 SV=1
9	AFDB:X6R9J3	0.452	0.668	1.247E-20	298	0.214	0.326	X6R9J3.pdb.gz	X6R9J3_HUMAN Prune homolog 2 with BCH domain OS=Homo sapiens OX=9606 GN=PRUNE2 PE=1 SV=1
10	AFDB:Q5SZG1	0.159	0.351	2.079E-19	178	0.393	1.000	Q5SZG1.pdb.gz	Q5SZG1_HUMAN Prune exopolyphosphatase 1 (Fragment) OS=Homo sapiens OX=9606 GN=PRUNE1 PE=1 SV=1
11	AFDB:Q8XIQ9	0.383	0.328	4.773E-15	549	0.148	0.122	Q8XIQ9.pdb.gz	IPYR_CLOPE Cobalt-dependent inorganic pyrophosphatase OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=CPE2055 PE=1 SV=1
12	PDB:5f55A	0.204	0.146	2.950E-6	705	0.124	0.079	5f55A.pdb.gz	Structural basis for DNA 5 -end resection by RecJ
13	PDB:5dgoA	0.249	0.217	4.991E-4	541	0.113	0.094	5dgoA.pdb.gz
14	PDB:6rawA	0.212	0.183	2.917E-3	542	0.102	0.085	6rawA.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
15	PDB:5cslA	0.113	0.038	1.096E-2	2050	0.079	0.018	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
16	PDB:2ob0C	0.097	0.211	1.445E-2	166	0.060	0.163	2ob0C.pdb.gz	Structure of Human MAK3 homolog
17	PDB:5cskB	0.122	0.041	2.246E-2	2017	0.071	0.016	5cskB.pdb.gz
18	PDB:5cskA	0.112	0.035	2.960E-2	1996	0.068	0.016	5cskA.pdb.gz
19	PDB:2zy2A	0.131	0.120	4.122E-2	521	0.093	0.081	2zy2A.pdb.gz	Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
20	PDB:1gs5A	0.117	0.160	6.064E-2	258	0.079	0.140	1gs5A.pdb.gz	Structure of Acetylglutamate Kinase, a Key Enzyme for Arginine Biosynthesis and a Prototype for the Amino Acid Kinase Enzyme Family, During Catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3ITN0	0.0	831	454	0.934	0.932	A0A3B3ITN0_HUMAN Prune exopolyphosphatase 1 OS=Homo sapiens OX=9606 GN=PRUNE1 PE=1 SV=1
2	Q86TP1	0.0	922	453	1.000	1.000	PRUN1_HUMAN Exopolyphosphatase PRUNE1 OS=Homo sapiens OX=9606 GN=PRUNE1 PE=1 SV=2
3	Q5SZG1	1.19e-116	340	178	0.393	1.000	Q5SZG1_HUMAN Prune exopolyphosphatase 1 (Fragment) OS=Homo sapiens OX=9606 GN=PRUNE1 PE=1 SV=1
4	A0A088AWP5	3.51e-59	212	3062	0.272	0.040	A0A088AWP5_HUMAN Prune homolog 2 with BCH domain OS=Homo sapiens OX=9606 GN=PRUNE2 PE=1 SV=1
5	Q8WUY3	4.02e-59	212	3088	0.272	0.040	PRUN2_HUMAN Protein prune homolog 2 OS=Homo sapiens OX=9606 GN=PRUNE2 PE=1 SV=3
6	X6R9J3	7.50e-49	171	298	0.230	0.349	X6R9J3_HUMAN Prune homolog 2 with BCH domain OS=Homo sapiens OX=9606 GN=PRUNE2 PE=1 SV=1
7	O18399	5.28e-44	160	405	0.274	0.306	O18399_DROME EG:152A3.5 protein (Fbgn0003116;pn protein) OS=Drosophila melanogaster OX=7227 GN=pn PE=1 SV=1
8	Q629J6	2.29e-41	152	365	0.258	0.321	Q629J6_DROME Prune OS=Drosophila melanogaster OX=7227 GN=pn PE=2 SV=1
9	Q24465	3.18e-27	114	404	0.243	0.272	Q24465_DROME Mutant prune OS=Drosophila melanogaster OX=7227 GN=pn PE=3 SV=1
10	O14094	2.30e-23	103	384	0.205	0.242	PPX1_SCHPO Putative exopolyphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2F3.11 PE=3 SV=1
11	P38698	9.33e-23	101	397	0.223	0.254	PPX1_YEAST Polyphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PPX1 PE=1 SV=1
12	Q38FJ8	1.16e-16	83.6	383	0.225	0.266	Q38FJ8_TRYB2 Acidocalcisomal exopolyphosphatase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.1950 PE=4 SV=1
13	P56223	1.4	33.5	301	0.044	0.066	PO6F1_RAT POU domain, class 6, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou6f1 PE=2 SV=1
14	Q07916	1.6	33.1	301	0.044	0.066	PO6F1_MOUSE POU domain, class 6, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou6f1 PE=1 SV=1
15	Q14863	1.7	33.1	301	0.044	0.066	PO6F1_HUMAN POU domain, class 6, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
16	Q5U4D4	1.7	33.5	576	0.044	0.035	Q5U4D4_MOUSE POU domain protein OS=Mus musculus OX=10090 GN=Pou6f1 PE=1 SV=1
17	A0A1C7CYY7	1.8	33.5	577	0.044	0.035	A0A1C7CYY7_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
18	A0A1C7CYV8	2.0	33.5	611	0.044	0.033	A0A1C7CYV8_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1
19	Q6FRB7	5.3	31.6	287	0.051	0.080	IPYR_CANGA Inorganic pyrophosphatase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=IPP1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01368 DHH	1.2e-05	37.0	DHH family
2	PF02833 DHHA2	3.4e-25	100.4	DHHA2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271620

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337060	0.994	Nucleoside diphosphate kinase A
2	9606.ENSP00000377814	0.907	Guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase MESH1
3	9606.ENSP00000362924	0.728	Gelsolin
4	9606.ENSP00000296484	0.692	POC1 centriolar protein homolog A
5	9606.ENSP00000481038	0.666	Cytoplasmic FMR1-interacting protein 1
6	9606.ENSP00000267859	0.653	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2
7	9606.ENSP00000324806	0.647	Glycogen synthase kinase-3 beta
8	9606.ENSP00000298767	0.621	Wings apart-like protein homolog
9	9606.ENSP00000258111	0.610	Calcium-activated potassium channel subunit beta-4
10	9606.ENSP00000266991	0.595	Desert hedgehog protein
11	9606.ENSP00000303758	0.587	Leucine zipper protein 1
12	9606.ENSP00000222330	0.578	Glycogen synthase kinase-3 alpha
13	9606.ENSP00000470087	0.545	Uncharacterized protein
14	9606.ENSP00000347719	0.525	Tubulin-specific chaperone D
15	9606.ENSP00000371308	0.519	Centromere protein J
16	9606.ENSP00000357425	0.513	Acid sphingomyelinase-like phosphodiesterase 3a
17	9606.ENSP00000363001	0.513	Acid sphingomyelinase-like phosphodiesterase 3b
18	9606.ENSP00000363017	0.512	Replication protein A 32 kDa subunit
19	9606.ENSP00000285243	0.509	Ankyrin repeat domain-containing protein 40

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015631	1.000	tubulin binding
GO:0016791	1.000	phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902903	0.997	regulation of supramolecular fiber organization
GO:0043254	0.996	regulation of protein-containing complex assembly
GO:0070507	0.995	regulation of microtubule cytoskeleton organization
GO:0031110	0.994	regulation of microtubule polymerization or depolymerization
GO:0032271	0.990	regulation of protein polymerization
GO:0060284	0.988	regulation of cell development
GO:0051960	0.980	regulation of nervous system development
GO:0031113	0.960	regulation of microtubule polymerization
GO:0050767	0.928	regulation of neurogenesis
GO:0009987	0.798	cellular process
GO:0008152	0.551	metabolic process
GO:0044237	0.450	cellular metabolic process
GO:0071704	0.361	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.813	organelle
GO:0043227	0.728	membrane-bounded organelle
GO:0043229	0.723	intracellular organelle
GO:0043231	0.390	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.

[back to server]