StarFunc result for job id Q86TW2

User Input

>input (530 residues)
MARKALKLASWTSMALAASGIYFYSNKYLDPNDFGAVRVGRAVATTAVISYDYLTSLKSV
PYGSEEYLQLRSKSWPVFLQVHLRSARRLCELCCANRGTFIKVGQHLGALDYLLPEEYTS
TLKVLHSQAPQSSMQEIRQVIREDLGKEIHDLFQSFDDTPLGTASLAQVHKAVLHDGRTV
AVKVQHPKVRAQSSKDILLMEVLVLAVKQLFPEFEFMWLVDEAKKNLPLELDFLNEGRNA
EKVSQMLRHFDFLKVPRIHWDLSTERVLLMEFVDGGQVNDRDYMERNKIDVNEISRHLGK
MYSEMIFVNGFVHCDPHPGNVLVRKHPGTGKAEIVLLDHGLYQMLTEEFRLNYCHLWQSL
IWTDMKRVKEYSQRLGAGDLYPLFACMLTARSWDSVNRGISQAPVTATEDLEIRNNAANY
LPQISHLLNHVPRQMLLILKTNDLLRGIEAALGTRASASSFLNMSRCCIRALAEHKKKNT
CSFFRRTQISFSEAFNLWQINLHELILRVKGLKLADRVLALICWLFPAPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86TW2	1.000	1.000	9.174E-86	530	1.000	1.000	Q86TW2.pdb.gz	ADCK1_HUMAN AarF domain-containing protein kinase 1 OS=Homo sapiens OX=9606 GN=ADCK1 PE=1 SV=2
2	AFDB:Q9D0L4	0.887	0.896	6.557E-71	525	0.870	0.878	Q9D0L4.pdb.gz	ADCK1_MOUSE AarF domain-containing protein kinase 1 OS=Mus musculus OX=10090 GN=Adck1 PE=1 SV=1
3	AFDB:Q9W133	0.883	0.903	8.480E-50	518	0.436	0.446	Q9W133.pdb.gz	ADCK_DROME AarF domain-containing kinase 1 OS=Drosophila melanogaster OX=7227 GN=Adck1 PE=1 SV=2
4	AFDB:Q3MIX3	0.827	0.759	6.732E-38	580	0.357	0.326	Q3MIX3.pdb.gz	ADCK5_HUMAN Uncharacterized aarF domain-containing protein kinase 5 OS=Homo sapiens OX=9606 GN=ADCK5 PE=1 SV=3
5	AFDB:Q80V03	0.819	0.751	7.057E-38	582	0.342	0.311	Q80V03.pdb.gz	ADCK5_MOUSE Uncharacterized aarF domain-containing protein kinase 5 OS=Mus musculus OX=10090 GN=Adck5 PE=2 SV=2
6	AFDB:Q54P00	0.816	0.634	7.852E-37	695	0.328	0.250	Q54P00.pdb.gz	ABKD_DICDI Probable serine/threonine-protein kinase abkD OS=Dictyostelium discoideum OX=44689 GN=abkD PE=2 SV=1
7	AFDB:Q06567	0.811	0.759	6.580E-36	569	0.304	0.283	Q06567.pdb.gz	MCP2_YEAST ABC1 family protein MCP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCP2 PE=1 SV=1
8	AFDB:O60111	0.751	0.718	7.321E-35	557	0.340	0.323	O60111.pdb.gz	MCP2L_SCHPO ABC1 family protein MCP2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC15C4.02 PE=3 SV=2
9	AFDB:Q389E8	0.774	0.635	1.248E-29	654	0.291	0.235	Q389E8.pdb.gz	Q389E8_TRYB2 ABC1 protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1840 PE=4 SV=1
10	AFDB:F4KIJ2	0.680	0.358	4.074E-25	1040	0.232	0.118	F4KIJ2.pdb.gz	F4KIJ2_ARATH ABC1 family protein OS=Arabidopsis thaliana OX=3702 GN=At5g24810 PE=1 SV=1
11	PDB:5yk1A	0.399	0.507	2.084E-13	401	0.174	0.229	5yk1A.pdb.gz	Discovery of the first macrolide antibiotic binding protein in Mycobacterium tuberculosis: a new antibiotic resistance drug target.
12	PDB:6zxfz	0.268	0.366	7.851E-5	373	0.072	0.102	6zxfz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
13	PDB:7cgaA	0.216	0.300	9.942E-5	347	0.104	0.159	7cgaA.pdb.gz
14	PDB:1k9aB	0.218	0.254	2.220E-4	441	0.085	0.102	1k9aB.pdb.gz
15	PDB:4fi1A	0.202	0.273	2.681E-4	371	0.100	0.143	4fi1A.pdb.gz	Crystal structure of scCK2 alpha in complex with ATP
16	PDB:3pvuA	0.239	0.214	3.732E-4	609	0.113	0.099	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
17	PDB:6zxdz	0.249	0.419	3.913E-4	292	0.092	0.168	6zxdz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
18	PDB:4c0tA	0.220	0.365	4.508E-4	291	0.072	0.131	4c0tA.pdb.gz
19	PDB:6b1uA	0.204	0.238	5.195E-4	442	0.070	0.084	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
20	PDB:6g18v	0.237	0.363	5.195E-4	325	0.074	0.120	6g18v.pdb.gz	Visualizing late states of human 40S ribosomal subunit maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86TW2	0.0	1104	530	1.000	1.000	ADCK1_HUMAN AarF domain-containing protein kinase 1 OS=Homo sapiens OX=9606 GN=ADCK1 PE=1 SV=2
2	Q9D0L4	0.0	937	525	0.874	0.882	ADCK1_MOUSE AarF domain-containing protein kinase 1 OS=Mus musculus OX=10090 GN=Adck1 PE=1 SV=1
3	Q9W133	5.25e-159	464	518	0.443	0.454	ADCK_DROME AarF domain-containing kinase 1 OS=Drosophila melanogaster OX=7227 GN=Adck1 PE=1 SV=2
4	Q3MIX3	5.91e-92	294	580	0.357	0.326	ADCK5_HUMAN Uncharacterized aarF domain-containing protein kinase 5 OS=Homo sapiens OX=9606 GN=ADCK5 PE=1 SV=3
5	Q80V03	2.83e-90	290	582	0.321	0.292	ADCK5_MOUSE Uncharacterized aarF domain-containing protein kinase 5 OS=Mus musculus OX=10090 GN=Adck5 PE=2 SV=2
6	O60111	1.96e-87	281	557	0.336	0.320	MCP2L_SCHPO ABC1 family protein MCP2 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC15C4.02 PE=3 SV=2
7	Q54P00	8.84e-84	276	695	0.336	0.256	ABKD_DICDI Probable serine/threonine-protein kinase abkD OS=Dictyostelium discoideum OX=44689 GN=abkD PE=2 SV=1
8	Q06567	2.45e-77	255	569	0.304	0.283	MCP2_YEAST ABC1 family protein MCP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCP2 PE=1 SV=1
9	Q389E8	9.80e-55	197	654	0.268	0.217	Q389E8_TRYB2 ABC1 protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1840 PE=4 SV=1
10	F4JRQ4	2.40e-44	165	481	0.249	0.274	F4JRQ4_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g24810 PE=1 SV=1
11	Q0WSU9	2.10e-42	160	479	0.213	0.236	Q0WSU9_ARATH At5g50330 OS=Arabidopsis thaliana OX=3702 GN=MXI22.4 PE=1 SV=1
12	F4KIJ2	4.15e-37	149	1040	0.191	0.097	F4KIJ2_ARATH ABC1 family protein OS=Arabidopsis thaliana OX=3702 GN=At5g24810 PE=1 SV=1
13	Q93Y08	1.46e-36	146	761	0.160	0.112	AB1K8_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K8 PE=2 SV=1
14	B9DGY1	8.52e-36	144	695	0.151	0.115	AB1K7_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K7 PE=1 SV=1
15	F4JFM1	1.01e-35	144	724	0.151	0.110	F4JFM1_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SIA1 PE=1 SV=1
16	Q18486	6.12e-34	139	755	0.175	0.123	COQ8_CAEEL Atypical kinase coq-8, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-8 PE=3 SV=2
17	O53343	2.91e-27	116	447	0.143	0.170	O53343_MYCTU Probable conserved ATP-binding protein ABC transporter OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3197 PE=1 SV=1
18	Q94BU1	8.25e-27	117	692	0.183	0.140	Y1181_ARATH Uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g71810 PE=1 SV=1
19	F4I8V6	4.80e-26	114	624	0.172	0.146	F4I8V6_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g11390 PE=1 SV=1
20	Q9MA15	6.68e-26	114	711	0.143	0.107	AB1K3_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.4e-88	307.7	ABC1 atypical kinase-like domain
2	PF01636 APH	1.3	20.3	Phosphotransferase enzyme family
3	PF18731 HEPN_Swt1	2.8e+02	13.2	Swt1-like HEPN
4	PF00069 Pkinase	0.0029	28.6	Protein kinase domain
5	PF11463 R-HINP1I	2.9e+02	12.4	R.HinP1I restriction endonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000238561

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254759	0.803	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
2	9606.ENSP00000333946	0.774	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
3	9606.ENSP00000318480	0.711	ATP-dependent zinc metalloprotease YME1L1
4	9606.ENSP00000387262	0.706	MICOS complex subunit MIC60
5	9606.ENSP00000322316	0.695	5-demethoxyubiquinone hydroxylase, mitochondrial
6	9606.ENSP00000262507	0.687	Ubiquinone biosynthesis protein COQ9, mitochondrial
7	9606.ENSP00000449089	0.674	Dynamin-1-like protein
8	9606.ENSP00000288532	0.648	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
9	9606.ENSP00000362354	0.641	Phosphatidate phosphatase LPIN3
10	9606.ENSP00000430985	0.641	Ankyrin repeat domain-containing protein 6
11	9606.ENSP00000360270	0.636	Metalloendopeptidase OMA1, mitochondrial
12	9606.ENSP00000480986	0.631	Nucleolar protein of 40 kDa
13	9606.ENSP00000370215	0.605	NADP-dependent oxidoreductase domain-containing protein 1
14	9606.ENSP00000348145	0.597	Uncharacterized protein C14orf178
15	9606.ENSP00000300452	0.555	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
16	9606.ENSP00000386456	0.540	AP2-associated protein kinase 1
17	9606.ENSP00000371607	0.525	Mitochondrial intermediate peptidase
18	9606.ENSP00000420617	0.518	Mitofusin-1
19	9606.ENSP00000265334	0.511	Cyclin-dependent kinase-like 3
20	9606.ENSP00000464788	0.509	Zinc finger protein 285

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.991	catalytic activity
GO:0016301	0.973	kinase activity
GO:0016773	0.945	phosphotransferase activity, alcohol group as acceptor
GO:0004672	0.929	protein kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0022603	0.928	regulation of anatomical structure morphogenesis
GO:0010822	0.895	positive regulation of mitochondrion organization
GO:0051093	0.877	negative regulation of developmental process
GO:0048523	0.798	negative regulation of cellular process
GO:0009987	0.793	cellular process
GO:0008152	0.750	metabolic process
GO:0010823	0.721	negative regulation of mitochondrion organization
GO:0071704	0.636	organic substance metabolic process
GO:0044238	0.567	primary metabolic process
GO:0044237	0.553	cellular metabolic process
GO:0006807	0.545	nitrogen compound metabolic process
GO:1901564	0.518	organonitrogen compound metabolic process
GO:0043170	0.477	macromolecule metabolic process
GO:0019538	0.439	protein metabolic process
GO:0006796	0.417	phosphate-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.-.-	0.973	Transferring phosphorus-containing groups.
EC:2.7.1.-	0.945	Phosphotransferases with an alcohol group as acceptor.

[back to server]