StarFunc result for job id Q86U28

User Input

>input (154 residues)
MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQIRLTDSCVQRL
LEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQ
VDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86U28	1.000	1.000	2.002E-28	154	1.000	1.000	Q86U28.pdb.gz	ISCA2_HUMAN Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA2 PE=1 SV=2
2	AFDB:Q9DCB8	0.721	0.721	1.059E-24	154	0.838	0.838	Q9DCB8.pdb.gz	ISCA2_MOUSE Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Isca2 PE=1 SV=2
3	AFDB:Q9XIK3	0.625	0.539	9.573E-13	180	0.312	0.267	Q9XIK3.pdb.gz	ISCAP_ARATH Iron-sulfur assembly protein IscA, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISCA PE=2 SV=2
4	AFDB:O43045	0.645	0.488	1.138E-11	205	0.338	0.254	O43045.pdb.gz	ISA2_SCHPO Iron-sulfur assembly protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=isa2 PE=3 SV=1
5	AFDB:P72731	0.632	0.809	3.373E-11	118	0.260	0.339	P72731.pdb.gz	Y1417_SYNY3 Uncharacterized protein slr1417 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1417 PE=3 SV=1
6	AFDB:P78859	0.639	0.525	3.373E-11	190	0.247	0.200	P78859.pdb.gz	ISA1_SCHPO Iron-sulfur assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=isa1 PE=2 SV=1
7	AFDB:P74596	0.635	0.849	7.854E-11	113	0.234	0.319	P74596.pdb.gz	Y1565_SYNY3 Uncharacterized protein slr1565 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1565 PE=1 SV=1
8	AFDB:P77667	0.631	0.786	9.999E-11	122	0.227	0.287	P77667.pdb.gz	SUFA_ECOLI Protein SufA OS=Escherichia coli (strain K12) OX=83333 GN=sufA PE=1 SV=1
9	AFDB:Q12425	0.615	0.520	1.621E-10	185	0.318	0.265	Q12425.pdb.gz	ISA2_YEAST Iron-sulfur assembly protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISA2 PE=1 SV=1
10	AFDB:Q07821	0.594	0.376	5.422E-10	250	0.273	0.168	Q07821.pdb.gz	ISA1_YEAST Iron-sulfur assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISA1 PE=1 SV=1
11	PDB:2d2aA	0.568	0.752	1.180E-8	114	0.227	0.307	2d2aA.pdb.gz
12	PDB:1r94A	0.520	0.790	4.194E-8	97	0.234	0.371	1r94A.pdb.gz
13	PDB:1yt3A	0.131	0.064	7.233E-1	375	0.071	0.029	1yt3A.pdb.gz	Crystal Structure of Escherichia coli RNase D, an Exoribonuclease Involved in Structured RNA Processing
14	PDB:2ztdA	0.176	0.152	8.162E-1	189	0.065	0.053	2ztdA.pdb.gz
15	PDB:5c0xK	0.139	0.086	8.670E-1	350	0.091	0.040	5c0xK.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
16	PDB:3fkyC	0.182	0.094	1.104	342	0.052	0.023	3fkyC.pdb.gz
17	PDB:7mt2W	0.100	0.180	1.684	77	0.039	0.078	7mt2W.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
18	PDB:1s5jA	0.104	0.031	1.789	727	0.045	0.010	1s5jA.pdb.gz	Insights into DNA replication: the crystal structure of DNA polymerase B1 from the archaeon Sulfolobus solfataricus
19	PDB:7pzyAL	0.159	0.274	1.789	77	0.039	0.078	7pzyAL.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
20	PDB:1c7yA	0.185	0.154	1.900	199	0.065	0.050	1c7yA.pdb.gz	Crystal structure of the holliday junction DNA in complex with a single RuvA tetramer.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q86U28	1.73e-109	309	154	1.000	1.000	ISCA2_HUMAN Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA2 PE=1 SV=2
2	Q9DCB8	8.57e-86	249	154	0.838	0.838	ISCA2_MOUSE Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Isca2 PE=1 SV=2
3	O43045	4.56e-23	92.0	205	0.292	0.220	ISA2_SCHPO Iron-sulfur assembly protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=isa2 PE=3 SV=1
4	P0ACC3	2.49e-19	80.1	114	0.253	0.342	ERPA_ECOLI Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain K12) OX=83333 GN=erpA PE=1 SV=1
5	P0AAC8	8.20e-16	70.9	107	0.273	0.393	ISCA_ECOLI Iron-binding protein IscA OS=Escherichia coli (strain K12) OX=83333 GN=iscA PE=1 SV=1
6	Q12425	5.92e-15	70.5	185	0.266	0.222	ISA2_YEAST Iron-sulfur assembly protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISA2 PE=1 SV=1
7	P72731	6.45e-15	68.6	118	0.253	0.331	Y1417_SYNY3 Uncharacterized protein slr1417 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1417 PE=3 SV=1
8	Q9XIK3	9.42e-15	69.7	180	0.292	0.250	ISCAP_ARATH Iron-sulfur assembly protein IscA, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ISCA PE=2 SV=2
9	B7J5X1	1.26e-14	67.8	107	0.195	0.280	B7J5X1_ACIF2 Iron-binding protein IscA OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) OX=243159 GN=iscA PE=3 SV=1
10	P74596	2.25e-14	67.0	113	0.234	0.319	Y1565_SYNY3 Uncharacterized protein slr1565 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1565 PE=1 SV=1
11	P77667	2.76e-14	67.0	122	0.240	0.303	SUFA_ECOLI Protein SufA OS=Escherichia coli (strain K12) OX=83333 GN=sufA PE=1 SV=1
12	P9WMN5	2.89e-13	64.3	118	0.201	0.263	Y2204_MYCTU Protein Rv2204c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2204c PE=1 SV=1
13	P78859	2.67e-10	58.2	190	0.240	0.195	ISA1_SCHPO Iron-sulfur assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=isa1 PE=2 SV=1
14	Q07821	3.98e-10	58.5	250	0.208	0.128	ISA1_YEAST Iron-sulfur assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ISA1 PE=1 SV=1
15	Q4QRC6	4.28e-09	53.5	129	0.247	0.295	ISCA1_DANRE Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Danio rerio OX=7955 GN=isca1 PE=2 SV=1
16	Q57W48	5.32e-09	54.3	173	0.247	0.220	Q57W48_TRYB2 Iron-sulfur assembly protein 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.280 PE=4 SV=1
17	Q9D924	1.79e-08	52.0	129	0.214	0.256	ISCA1_MOUSE Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Isca1 PE=2 SV=1
18	Q9BUE6	2.45e-08	51.6	129	0.214	0.256	ISCA1_HUMAN Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA1 PE=1 SV=1
19	I3ITR1	9.89e-08	50.1	129	0.169	0.202	I3ITR1_MOUSE cDNA sequence AK157302 OS=Mus musculus OX=10090 GN=AK157302 PE=3 SV=1
20	Q8T3X9	1.62e-07	49.7	130	0.169	0.200	ISCA1_DROME Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MagR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01521 Fe-S_biosyn	6e-12	57.1	Iron-sulphur cluster biosynthesis

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000452007

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328570	0.998	Glutaredoxin-related protein 5, mitochondrial
2	9606.ENSP00000355672	0.997	Putative transferase CAF17, mitochondrial
3	9606.ENSP00000216027	0.992	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
4	9606.ENSP00000387219	0.968	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
5	9606.ENSP00000310623	0.950	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
6	9606.ENSP00000261434	0.934	Lipoyl synthase, mitochondrial
7	9606.ENSP00000331369	0.930	BolA-like protein 3
8	9606.ENSP00000363205	0.909	Cysteine desulfurase, mitochondrial
9	9606.ENSP00000420026	0.889	LYR motif-containing protein 4
10	9606.ENSP00000365159	0.885	Iron-sulfur cluster assembly 1 homolog, mitochondrial
11	9606.ENSP00000377311	0.871	Ferredoxin-2, mitochondrial
12	9606.ENSP00000366482	0.862	Frataxin, mitochondrial
13	9606.ENSP00000358149	0.855	BolA-like protein 1
14	9606.ENSP00000281081	0.849	Iron-sulfur protein NUBPL
15	9606.ENSP00000253577	0.832	ATP-binding cassette sub-family B member 7, mitochondrial
16	9606.ENSP00000260270	0.832	Adrenodoxin, mitochondrial
17	9606.ENSP00000357633	0.812	Glutaredoxin-3
18	9606.ENSP00000297185	0.740	Stress-70 protein, mitochondrial
19	9606.ENSP00000372326	0.735	Ferrochelatase, mitochondrial
20	9606.ENSP00000264954	0.727	GrpE protein homolog 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0043167	0.506	ion binding
GO:0051536	0.495	iron-sulfur cluster binding
GO:0051537	0.388	2 iron, 2 sulfur cluster binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0031163	0.977	metallo-sulfur cluster assembly
GO:0006790	0.967	sulfur compound metabolic process
GO:0016226	0.960	iron-sulfur cluster assembly
GO:0071704	0.900	organic substance metabolic process
GO:0006807	0.703	nitrogen compound metabolic process
GO:0044238	0.561	primary metabolic process
GO:1901564	0.545	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005759	0.922	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]