StarFunc result for job id Q86U70

User Input

>input (411 residues)
MSVGCACPGCSSKSFKLYSPKEPPNGNAFPPFHPGTMLDRDVGPTPMYPPTYLEPGIGRH
TPYGNQTDYRIFELNKRLQNWTEECDNLWWDAFTTEFFEDDAMLTITFCLEDGPKRYTIG
RTLIPRYFRSIFEGGATELYYVLKHPKEAFHSNFVSLDCDQGSMVTQHGKPMFTQVCVEG
RLYLEFMFDDMMRIKTWHFSIRQHRELIPRSILAMHAQDPQMLDQLSKNITRCGLSNSTL
NYLRLCVILEPMQELMSRHKTYSLSPRDCLKTCLFQKWQRMVAPPAEPTRQQPSKRRKRK
MSGGSTMSSGGGNTNNSNSKKKSPASTFALSSQVPDVMVVGEPTLMGGEFGDEDERLITR
LENTQFDAANGIDDEDSFNNSPALGANSPWNSKPPSSQESKSENPTSQASQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RYF3	0.592	0.526	2.448E-69	467	0.993	0.874	B2RYF3.pdb.gz	B2RYF3_RAT Ldb1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ldb1 PE=2 SV=1
2	AFDB:Q7KVG9	0.570	0.407	7.261E-47	596	0.557	0.384	Q7KVG9.pdb.gz	Q7KVG9_DROME Chip, isoform B OS=Drosophila melanogaster OX=7227 GN=Chi PE=2 SV=1
3	AFDB:Q9U3E2	0.459	0.306	5.916E-25	629	0.319	0.208	Q9U3E2.pdb.gz	Q9U3E2_CAEEL LIM interaction domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ldb-1 PE=1 SV=1
4	AFDB:Q07684	0.438	0.396	9.011E-16	458	0.114	0.103	Q07684.pdb.gz	MFG1_YEAST Morphogenetic regulator of filamentous growth protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MFG1 PE=1 SV=1
5	PDB:3ff0A	0.210	0.422	1.256E-5	162	0.041	0.105	3ff0A.pdb.gz
6	PDB:2bngC	0.194	0.454	2.995E-4	140	0.056	0.164	2bngC.pdb.gz	Structure of an Atypical Epoxide Hydrolase from Mycobacterium Tuberculosis Gives Insights Into its Function.
7	PDB:1eg9B	0.250	0.487	3.788E-4	193	0.015	0.031	1eg9B.pdb.gz	Substrate binding site of naphthalene 1,2-dioxygenase: functional implications of indole binding.
8	PDB:2bmoB	0.245	0.478	7.664E-4	194	0.015	0.031	2bmoB.pdb.gz	Structural insight into the dioxygenation of nitroarene compounds: the crystal structure of nitrobenzene dioxygenase.
9	PDB:5x9jB	0.218	0.489	7.664E-4	152	0.036	0.099	5x9jB.pdb.gz
10	PDB:1gybA	0.204	0.573	1.028E-3	122	0.034	0.115	1gybA.pdb.gz	Structural Basis for the Interaction between Ntf2 and Nucleoporin Fxfg Repeats
11	PDB:2a15A	0.228	0.577	1.226E-3	133	0.036	0.113	2a15A.pdb.gz	Crystal structure of Mycobacterium tuberculosis Rv0760c at 1.50 A resolution, a structural homolog of Delta(5)-3-ketosteroid isomerase
12	PDB:1of5B	0.195	0.510	1.300E-3	128	0.032	0.102	1of5B.pdb.gz
13	PDB:4wwuC	0.230	0.502	1.462E-3	165	0.034	0.085	4wwuC.pdb.gz	Domain organization within the nuclear export factor Mex67:Mtr2 generates an extended mRNA binding surface.
14	PDB:7q04A	0.237	0.566	1.645E-3	154	0.041	0.110	7q04A.pdb.gz	Biochemical and structural characterization of an aromatic ring-hydroxylating dioxygenase for terephthalic acid catabolism.
15	AFDB:A8MR03	0.093	0.108	3.811E-3	338	0.090	0.109	A8MR03.pdb.gz	A8MR03_ARATH Splicing factor YJU2 OS=Arabidopsis thaliana OX=3702 GN=CWC16B PE=1 SV=1
16	AFDB:P16872	0.070	0.064	1.387E-2	459	0.085	0.076	P16872.pdb.gz	IL7RA_MOUSE Interleukin-7 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il7r PE=1 SV=2
17	AFDB:Q5RKR3	0.100	0.068	1.471E-2	745	0.131	0.072	Q5RKR3.pdb.gz	ISLR2_MOUSE Immunoglobulin superfamily containing leucine-rich repeat protein 2 OS=Mus musculus OX=10090 GN=Islr2 PE=1 SV=1
18	AFDB:Q9VU86	0.075	0.028	2.220E-2	1873	0.117	0.026	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
19	AFDB:P22814	0.070	0.063	3.157E-2	510	0.124	0.100	P22814.pdb.gz	RUNT_DROME Segmentation protein Runt OS=Drosophila melanogaster OX=7227 GN=run PE=1 SV=2
20	AFDB:Q9SWG3	0.078	0.048	3.348E-2	827	0.107	0.053	Q9SWG3.pdb.gz	FAR1_ARATH Protein FAR-RED IMPAIRED RESPONSE 1 OS=Arabidopsis thaliana OX=3702 GN=FAR1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVQ2	0.0	862	411	0.998	0.998	A0A0G2JVQ2_RAT LIM domain binding 1 OS=Rattus norvegicus OX=10116 GN=Ldb1 PE=1 SV=1
2	A0A8I5ZVT6	0.0	631	319	0.725	0.934	A0A8I5ZVT6_RAT LIM domain binding 1 OS=Rattus norvegicus OX=10116 GN=Ldb1 PE=4 SV=1
3	A0A8I6G409	0.0	846	412	0.983	0.981	A0A8I6G409_RAT LIM domain binding 1 OS=Rattus norvegicus OX=10116 GN=Ldb1 PE=1 SV=1
4	B2RYF3	0.0	854	467	0.993	0.874	B2RYF3_RAT Ldb1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ldb1 PE=2 SV=1
5	D3ZT89	0.0	786	375	0.910	0.997	D3ZT89_RAT LIM domain binding 1 OS=Rattus norvegicus OX=10116 GN=Ldb1 PE=3 SV=1
6	F2Z5G6	0.0	862	411	0.998	0.998	F2Z5G6_PIG LIM domain binding 1 OS=Sus scrofa OX=9823 GN=LDB1 PE=3 SV=4
7	G5E9Y7	0.0	583	371	0.672	0.744	G5E9Y7_HUMAN LIM domain binding 2 OS=Homo sapiens OX=9606 GN=LDB2 PE=1 SV=1
8	O43679	0.0	593	373	0.676	0.745	LDB2_HUMAN LIM domain-binding protein 2 OS=Homo sapiens OX=9606 GN=LDB2 PE=1 SV=1
9	O55203	0.0	594	373	0.681	0.751	LDB2_MOUSE LIM domain-binding protein 2 OS=Mus musculus OX=10090 GN=Ldb2 PE=1 SV=2
10	O73713	0.0	547	385	0.650	0.694	O73713_DANRE LIM domain-binding protein 2 OS=Danio rerio OX=7955 GN=ldb2 PE=2 SV=1
11	O73715	0.0	682	374	0.842	0.925	LDB1A_DANRE LIM domain-binding protein 1-A OS=Danio rerio OX=7955 GN=ldb1a PE=2 SV=1
12	P70060	0.0	776	375	0.898	0.984	LDB1_XENLA LIM domain-binding protein 1 OS=Xenopus laevis OX=8355 GN=ldb1 PE=1 SV=2
13	P70662	0.0	862	411	0.998	0.998	LDB1_MOUSE LIM domain-binding protein 1 OS=Mus musculus OX=10090 GN=Ldb1 PE=1 SV=2
14	Q05KH5	0.0	775	373	0.903	0.995	Q05KH5_PIG CLIM2 OS=Sus scrofa OX=9823 PE=2 SV=1
15	Q86U70	0.0	863	411	1.000	1.000	LDB1_HUMAN LIM domain-binding protein 1 OS=Homo sapiens OX=9606 GN=LDB1 PE=1 SV=2
16	H0YA09	1.21e-172	486	294	0.560	0.782	H0YA09_HUMAN LIM domain binding 2 (Fragment) OS=Homo sapiens OX=9606 GN=LDB2 PE=1 SV=1
17	E9PFI4	4.16e-161	457	313	0.518	0.681	E9PFI4_HUMAN LIM domain binding 2 OS=Homo sapiens OX=9606 GN=LDB2 PE=1 SV=1
18	O18353	3.23e-155	452	577	0.540	0.385	O18353_DROME CHIP OS=Drosophila melanogaster OX=7227 GN=Chi PE=1 SV=1
19	Q7KVG9	1.39e-154	451	596	0.540	0.372	Q7KVG9_DROME Chip, isoform B OS=Drosophila melanogaster OX=7227 GN=Chi PE=2 SV=1
20	G5EEL0	2.04e-42	159	592	0.277	0.193	LIDB1_CAEEL LIM domain-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=ldb-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17916 LID	2.8e-08	44.7	LIM interaction domain (LID)
2	PF01803 LIM_bind	2.1e-48	176.5	LIM-domain binding protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010354448.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010356723.1	0.991	LIM domain only 2
2	61622.XP_010384334.1	0.971	Single stranded DNA binding protein 2
3	61622.XP_010355175.1	0.969	TAL bHLH transcription factor 1, erythroid differentiation factor
4	61622.XP_010355188.1	0.969	T-cell acute lymphocytic leukemia protein 1-like
5	61622.XP_010359565.1	0.961	LIM domain only 1
6	61622.XP_010362709.1	0.952	ISL LIM homeobox 1
7	61622.XP_010371043.1	0.948	LIM homeobox 3
8	61622.XP_010359390.1	0.943	GATA binding protein 1
9	61622.XP_010364140.1	0.940	LIM/homeobox protein Lhx2 isoform X1
10	61622.XP_010371119.1	0.940	Single-stranded DNA-binding protein 3
11	61622.XP_010362977.1	0.934	Pygopus family PHD finger 2
12	61622.XP_010373947.1	0.930	LIM/homeobox protein Lhx4
13	61622.XP_010374100.1	0.924	Transcription factor 4 isoform X1
14	61622.XP_010361952.1	0.916	Transducin-like enhancer protein 3 isoform X1
15	61622.XP_010356545.1	0.914	LIM homeobox 9
16	61622.XP_010351736.1	0.913	Transducin-like enhancer protein 1 isoform X1
17	61622.XP_010372324.1	0.913	Transducin-like enhancer protein 4
18	61622.XP_010352559.1	0.911	Ring finger protein, LIM domain interacting
19	61622.XP_010364178.1	0.903	LIM homeobox transcription factor 1-beta isoform X1
20	61622.XP_010372596.1	0.899	Catenin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140297	0.744	DNA-binding transcription factor binding
GO:0140110	0.636	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0006357	0.992	regulation of transcription by RNA polymerase II
GO:0048519	0.991	negative regulation of biological process
GO:0048523	0.975	negative regulation of cellular process
GO:0048522	0.970	positive regulation of cellular process
GO:0010604	0.908	positive regulation of macromolecule metabolic process
GO:0045935	0.895	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.835	positive regulation of biosynthetic process
GO:0051254	0.835	positive regulation of RNA metabolic process
GO:0045893	0.834	positive regulation of DNA-templated transcription
GO:0051253	0.826	negative regulation of RNA metabolic process
GO:0010558	0.803	negative regulation of macromolecule biosynthetic process
GO:0031327	0.793	negative regulation of cellular biosynthetic process
GO:0045944	0.750	positive regulation of transcription by RNA polymerase II
GO:0045892	0.662	negative regulation of DNA-templated transcription
GO:0009987	0.565	cellular process
GO:0048856	0.343	anatomical structure development
GO:0032501	0.312	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.956	nuclear lumen
GO:0005654	0.923	nucleoplasm
GO:0032991	0.519	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]