StarFunc result for job id Q86U86

User Input

>input (1689 residues)
MGSKRRRATSPSSSVSGDFDDGHHSVSTPGPSRKRRRLSNLPTVDPIAVCHELYNTIRDY
KDEQGRLLCELFIRAPKRRNQPDYYEVVSQPIDLMKIQQKLKMEEYDDVNLLTADFQLLF
NNAKSYYKPDSPEYKAACKLWDLYLRTRNEFVQKGEADDEDDDEDGQDNQGTVTEGSSPA
YLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIKEPIDLKTIAQRIQNG
SYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKDANSIKKIFYMKKAEIEHHEMAKSSLRMR
TPSNLAAARLTGPSHSKGSLGEERNPTSKYYRNKRAVQGGRLSAITMALQYGSESEEDAA
LAAARYEEGESEAESITSFMDVSNPFYQLYDTVRSCRNNQGQLIAEPFYHLPSKKKYPDY
YQQIKMPISLQQIRTKLKNQEYETLDHLECDLNLMFENAKRYNVPNSAIYKRVLKLQQVM
QAKKKELARRDDIEDGDSMISSATSDTGSAKRKSKKNIRKQRMKILFNVVLEAREPGSGR
RLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRNDKYAGEEGMIEDMKLMFRNARHY
NEEGSQVYNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQ
KLNEVYEAVKNYTDKRGRRLSAIFLRLPSRSELPDYYLTIKKPMDMEKIRSHMMANKYQD
IDSMVEDFVMMFNNACTYNEPESLIYKDALVLHKVLLETRRDLEGDEDSHVPNVTLLIQE
LIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLTFDIIRKNVENNRYRRLDLF
QEHMFEVLERARRMNRTDSEIYEDAVELQQFFIKIRDELCKNGEILLSPALSYTTKHLHN
DVEKERKEKLPKEIEEDKLKREEEKREAEKSEDSSGAAGLSGLHRTYSQDCSFKNSMYHV
GDYVYVEPAEANLQPHIVCIERLWEDSAGEKWLYGCWFYRPNETFHLATRKFLEKEVFKS
DYYNKVPVSKILGKCVVMFVKEYFKLCPENFRDEDVFVCESRYSAKTKSFKKIKLWTMPI
SSVRFVPRDVPLPVVRVASVFANADKGDDEKNTDNSEDSRAEDNFNLEKEKEDVPVEMSN
GEPGCHYFEQLHYNDMWLKVGDCVFIKSHGLVRPRVGRIEKVWVRDGAAYFYGPIFIHPE
ETEHEPTKMFYKKEVFLSNLEETCPMTCILGKCAVLSFKDFLSCRPTEIPENDILLCESR
YNESDKQMKKFKGLKRFSLSAKVVDDEIYYFRKPIVPQKEPSPLLEKKIQLLEAKFAELE
GGDDDIEEMGEEDSEVIEPPSLPQLQTPLASELDLMPYTPPQSTPKSAKGSAKKEGSKRK
INMSGYILFSSEMRAVIKAQHPDYSFGELSRLVGTEWRNLETAKKAEYEERAAKVAEQQE
RERAAQQQQPSASPRAGTPVGALMGVVPPPTPMGMLNQQLTPVAGMMGGYPPGLPPLQGP
VDGLVSMGSMQPLHPGGPPPHHLPPGVPGLPGIPPPGVMNQGVAPMVGTPAPGGSPYGQQ
VGVLGPPGQQAPPPYPGPHPAGPPVIQQPTTPMFVAPPPKTQRLLHSEAYLKYIEGLSAE
SNSISKWDQTLAARRRDVHLSKEQESRLPSHWLKSKGAHTTMADALWRLRDLMLRDTLNI
RQAYNLENV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86U86	1.000	1.000	0.000	1689	1.000	1.000	Q86U86.pdb.gz	PB1_HUMAN Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1 PE=1 SV=1
2	AFDB:Q9VC36	0.208	0.211	0.000	1654	0.345	0.352	Q9VC36.pdb.gz	Q9VC36_DROME Polybromo OS=Drosophila melanogaster OX=7227 GN=polybromo PE=1 SV=1
3	AFDB:G5EEY5	0.256	0.232	8.607E-93	1883	0.317	0.284	G5EEY5.pdb.gz	G5EEY5_CAEEL Bromo domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pbrm-1 PE=1 SV=1
4	AFDB:Q09948	0.070	0.208	1.158E-13	542	0.046	0.144	Q09948.pdb.gz	RSC4_SCHPO Chromatin structure-remodeling complex subunit rsc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsc4 PE=1 SV=1
5	PDB:5z8lA	0.068	0.520	3.720E-8	204	0.021	0.176	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
6	AFDB:G5EGM3	0.083	0.080	4.212E-8	1744	0.065	0.062	G5EGM3.pdb.gz	TAF1_CAEEL Transcription initiation factor TFIID subunit 1 OS=Caenorhabditis elegans OX=6239 GN=taf-1 PE=2 SV=1
7	AFDB:Q3TKT4	0.075	0.078	5.066E-7	1613	0.036	0.038	Q3TKT4.pdb.gz	SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus OX=10090 GN=Smarca4 PE=1 SV=1
8	AFDB:Q7ZSY3	0.075	0.078	1.273E-6	1627	0.036	0.037	Q7ZSY3.pdb.gz	Q7ZSY3_DANRE Brahma protein-like protein 1 OS=Danio rerio OX=7955 GN=smarca4 PE=1 SV=1
9	AFDB:Q6DIC0	0.078	0.084	2.017E-6	1577	0.032	0.034	Q6DIC0.pdb.gz	SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus OX=10090 GN=Smarca2 PE=1 SV=1
10	AFDB:A0A0R4IJ25	0.077	0.081	3.053E-6	1604	0.030	0.031	A0A0R4IJ25.pdb.gz
11	PDB:7aoaD	0.054	0.250	4.476E-5	343	0.019	0.093	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
12	AFDB:P35713	0.040	0.163	5.559E-4	384	0.047	0.208	P35713.pdb.gz	SOX18_HUMAN Transcription factor SOX-18 OS=Homo sapiens OX=9606 GN=SOX18 PE=1 SV=2
13	PDB:7ay1A	0.057	0.078	1.125E-2	1033	0.067	0.109	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
14	PDB:5ikjA	0.042	0.149	1.867E-2	448	0.020	0.076	5ikjA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
15	PDB:1tr2B	0.042	0.056	1.955E-2	1029	0.060	0.098	1tr2B.pdb.gz
16	PDB:7pksh	0.068	0.101	3.245E-2	887	0.059	0.113	7pksh.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
17	PDB:6v8oO	0.046	0.175	4.480E-2	384	0.037	0.164	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
18	PDB:7lbm2	0.071	0.107	6.781E-2	897	0.043	0.080	7lbm2.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
19	PDB:2xwuB	0.061	0.083	1.125E-1	910	0.043	0.080	2xwuB.pdb.gz
20	PDB:7mqaSP	0.060	0.052	1.292E-1	2485	0.062	0.042	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZMW9	0.0	3426	1704	0.975	0.966	A0A8I5ZMW9_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1
2	A0A8I6AR61	0.0	3065	1634	0.943	0.974	A0A8I6AR61_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1
3	A0A8I6AV81	0.0	2992	1624	0.927	0.964	A0A8I6AV81_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1
4	A0A8I6G5U9	0.0	2886	1587	0.873	0.929	A0A8I6G5U9_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=1
5	B7FNJ0	0.0	832	1680	0.333	0.335	B7FNJ0_DROME FI03643p (Fragment) OS=Drosophila melanogaster OX=7227 GN=polybromo-RA PE=2 SV=1
6	D3ZT52	0.0	3257	1652	0.937	0.958	D3ZT52_RAT Polybromo 1 OS=Rattus norvegicus OX=10116 GN=Pbrm1 PE=1 SV=3
7	E7EVG2	0.0	2991	1460	0.864	1.000	E7EVG2_HUMAN Polybromo 1 (Fragment) OS=Homo sapiens OX=9606 GN=PBRM1 PE=1 SV=8
8	H0Y5B5	0.0	2200	1085	0.634	0.986	H0Y5B5_HUMAN Polybromo 1 (Fragment) OS=Homo sapiens OX=9606 GN=PBRM1 PE=1 SV=1
9	Q7YU13	0.0	830	1654	0.332	0.339	Q7YU13_DROME LD26355p OS=Drosophila melanogaster OX=7227 GN=polybromo PE=2 SV=1
10	Q86U86	0.0	3508	1689	1.000	1.000	PB1_HUMAN Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1 PE=1 SV=1
11	Q8BSQ9	0.0	3085	1634	0.949	0.981	PB1_MOUSE Protein polybromo-1 OS=Mus musculus OX=10090 GN=Pbrm1 PE=1 SV=4
12	Q9VC36	0.0	834	1654	0.333	0.340	Q9VC36_DROME Polybromo OS=Drosophila melanogaster OX=7227 GN=polybromo PE=1 SV=1
13	C9JPI5	3.32e-156	477	230	0.136	1.000	C9JPI5_HUMAN Polybromo 1 (Fragment) OS=Homo sapiens OX=9606 GN=PBRM1 PE=1 SV=1
14	G5EEY5	8.50e-136	468	1883	0.220	0.198	G5EEY5_CAEEL Bromo domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pbrm-1 PE=1 SV=1
15	Q09948	5.50e-28	123	542	0.043	0.133	RSC4_SCHPO Chromatin structure-remodeling complex subunit rsc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsc4 PE=1 SV=1
16	O74964	3.96e-27	122	803	0.046	0.096	RSC1_SCHPO Chromatin structure-remodeling complex subunit rsc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsc1 PE=1 SV=1
17	Q06488	4.24e-20	99.8	889	0.027	0.052	RSC2_YEAST Chromatin structure-remodeling complex subunit RSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSC2 PE=1 SV=1
18	A0A8I5ZUT5	3.31e-19	91.7	260	0.024	0.154	A0A8I5ZUT5_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=4 SV=1
19	A0A2R8Y5K3	4.31e-19	95.5	522	0.025	0.080	A0A2R8Y5K3_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=1
20	A0A8I6A8Z4	4.45e-19	91.7	278	0.024	0.144	A0A8I6A8Z4_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01426 BAH	9.4e-49	175.7	BAH domain
2	PF00439 Bromodomain	3e-109	368.6	Bromodomain
3	PF00505 HMG_box	6.3e-11	53.9	HMG (high mobility group) box
4	PF09011 HMG_box_2	5.5e-07	41.4	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008739

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000021768	0.999	AT rich interactive domain 2 (ARID, RFX-like)
2	61853.ENSNLEP00000002500	0.994	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1
3	61853.ENSNLEP00000021282	0.993	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2
4	61853.ENSNLEP00000021627	0.992	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1
5	61853.ENSNLEP00000007734	0.991	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1
6	61853.ENSNLEP00000000282	0.989	PHD finger protein 10
7	61853.ENSNLEP00000005008	0.988	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2
8	61853.ENSNLEP00000005368	0.988	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3
9	61853.ENSNLEP00000014469	0.985	Actin-like 6B
10	61853.ENSNLEP00000000633	0.984	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1
11	61853.ENSNLEP00000007056	0.984	Actin-like 6A
12	61853.ENSNLEP00000001015	0.978	Bromodomain containing 7
13	61853.ENSNLEP00000010477	0.971	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
14	61853.ENSNLEP00000015131	0.970	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
15	61853.ENSNLEP00000002949	0.967	D4, zinc and double PHD fingers, family 3
16	61853.ENSNLEP00000023571	0.952	Uncharacterized protein
17	61853.ENSNLEP00000011400	0.936	AT rich interactive domain 1A (SWI-like)
18	61853.ENSNLEP00000019002	0.936	AT rich interactive domain 1B (SWI1-like)
19	61853.ENSNLEP00000020571	0.920	D4, zinc and double PHD fingers family 1
20	61853.ENSNLEP00000023255	0.911	Actin, gamma 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.665	chromatin binding
GO:0003677	0.445	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0060998	0.971	regulation of dendritic spine development
GO:0048518	0.962	positive regulation of biological process
GO:0060999	0.936	positive regulation of dendritic spine development
GO:0009987	0.859	cellular process
GO:0016043	0.748	cellular component organization
GO:0050794	0.712	regulation of cellular process
GO:0006325	0.680	chromatin organization
GO:0048519	0.585	negative regulation of biological process
GO:0019222	0.549	regulation of metabolic process
GO:0048523	0.542	negative regulation of cellular process
GO:0010468	0.537	regulation of gene expression
GO:0019219	0.480	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.470	regulation of cellular biosynthetic process
GO:0010556	0.466	regulation of macromolecule biosynthetic process
GO:2001141	0.431	regulation of RNA biosynthetic process
GO:0032502	0.427	developmental process
GO:0006355	0.423	regulation of DNA-templated transcription
GO:0032501	0.413	multicellular organismal process
GO:0048856	0.413	anatomical structure development
GO:0007275	0.319	multicellular organism development
GO:0048731	0.303	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.966	protein-containing complex
GO:0043232	0.958	intracellular non-membrane-bounded organelle
GO:0005694	0.859	chromosome
GO:1902494	0.831	catalytic complex
GO:0000785	0.733	chromatin
GO:0070603	0.620	SWI/SNF superfamily-type complex
GO:0005737	0.363	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]