StarFunc result for job id Q86UE4

User Input

>input (582 residues)
MAARSWQDELAQQAEEGSARLREMLSVGLGFLRTELGLDLGLEPKRYPGWVILVGTGALG
LLLLFLLGYGWAAACAGARKKRRSPPRKREEAAAVPAAAPDDLALLKNLRSEEQKKKNRK
KLSEKPKPNGRTVEVAEGEAVRTPQSVTAKQPPEIDKKNEKSKKNKKKSKSDAKAVQNSS
RHDGKEVDEGAWETKISHREKRQQRKRDKVLTDSGSLDSTIPGIENTITVTTEQLTTASF
PVGSKKNKGDSHLNVQVSNFKSGKGDSTLQVSSGLNENLTVNGGGWNEKSVKLSSQISAG
EEKWNSVSPASAGKRKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQST
TSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIP
DDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQDTEELEKEIREDLPVNTSKT
RPKQEKAFSLKTISTSDPAEVLVKNSQPIKTLPPATSTEPSVILSKSDSDKSSSQVPPIL
QETDKSKSNTKQNSVPPSQTKSETSWESPKQIKKKKKARRET

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9D2	0.171	0.171	2.144E-70	582	1.000	1.000	A0A024R9D2.pdb.gz
2	AFDB:E5RJU9	0.116	0.125	3.705E-60	526	0.899	0.994	E5RJU9.pdb.gz	E5RJU9_HUMAN Metadherin OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=1
3	AFDB:P82179	0.091	0.077	3.340E-2	701	0.179	0.148	P82179.pdb.gz	TRDN_CANLF Triadin OS=Canis lupus familiaris OX=9615 GN=TRDN PE=1 SV=2
4	AFDB:Q8I4M5	0.068	0.041	5.664E-2	1052	0.141	0.078	Q8I4M5.pdb.gz	GLS1_CAEEL Germline survival defective-1 OS=Caenorhabditis elegans OX=6239 GN=gls-1 PE=1 SV=2
5	AFDB:Q8R4I1	0.072	0.053	1.336E-1	867	0.129	0.087	Q8R4I1.pdb.gz	ATX7_MOUSE Ataxin-7 OS=Mus musculus OX=10090 GN=Atxn7 PE=1 SV=2
6	AFDB:A0A024R162	0.064	0.075	1.986E-1	484	0.105	0.126	A0A024R162.pdb.gz
7	AFDB:Q5VWT5	0.053	0.044	2.421E-1	728	0.131	0.104	Q5VWT5.pdb.gz	FYB2_HUMAN FYN-binding protein 2 OS=Homo sapiens OX=9606 GN=FYB2 PE=1 SV=1
8	AFDB:Q63257	0.077	0.061	2.421E-1	801	0.134	0.097	Q63257.pdb.gz	IL4RA_RAT Interleukin-4 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il4r PE=2 SV=2
9	AFDB:O15231	0.059	0.053	3.368E-1	689	0.141	0.119	O15231.pdb.gz	ZN185_HUMAN Zinc finger protein 185 OS=Homo sapiens OX=9606 GN=ZNF185 PE=1 SV=3
10	AFDB:Q9FUY2	0.073	0.051	3.368E-1	931	0.120	0.075	Q9FUY2.pdb.gz	LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=2
11	PDB:3r0qG	0.060	0.098	4.438	353	0.009	0.014	3r0qG.pdb.gz	Crystal structure of the plant epigenetic protein arginine methyltransferase 10.
12	PDB:6v8oE	0.032	0.097	6.596	120	0.019	0.092	6v8oE.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
13	PDB:7np7B4	0.073	0.086	7.046	480	0.021	0.025	7np7B4.pdb.gz
14	PDB:5n9jZ	0.062	0.240	8.041	119	0.019	0.092	5n9jZ.pdb.gz
15	PDB:6ke6A8	0.052	0.053	8.041	548	0.014	0.015	6ke6A8.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome
16	PDB:5svaU	0.060	0.180	8.590	156	0.029	0.109	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
17	PDB:3j7aU	0.047	0.135	9.802	149	0.014	0.054	3j7aU.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.
18	PDB:7z0oE	0.081	0.145	9.802	301	0.024	0.047	7z0oE.pdb.gz	Mechanism of RNA polymerase I selection by transcription factor UAF.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5RJU9	0.0	1022	526	0.902	0.998	E5RJU9_HUMAN Metadherin OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=1
2	Q80WJ7	0.0	932	579	0.911	0.915	LYRIC_MOUSE Protein LYRIC OS=Mus musculus OX=10090 GN=Mtdh PE=1 SV=1
3	Q86UE4	0.0	1157	582	1.000	1.000	LYRIC_HUMAN Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2
4	Q9Z1W6	0.0	910	581	0.904	0.905	LYRIC_RAT Protein LYRIC OS=Rattus norvegicus OX=10116 GN=Mtdh PE=1 SV=2
5	H0YB56	1.37e-131	385	224	0.383	0.996	H0YB56_HUMAN Metadherin (Fragment) OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=1
6	H0YBJ8	5.15e-103	311	188	0.323	1.000	H0YBJ8_HUMAN Metadherin (Fragment) OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=1
7	Q6H6M5	0.084	37.4	232	0.046	0.116	INP1_ORYSJ Protein INAPERTURATE POLLEN 1 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=INP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15686 LYRIC	6.4e-161	548.1	Lysine-rich CEACAM1 co-isolated protein family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338235

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346762	0.995	Staphylococcal nuclease domain-containing protein 1
2	9606.ENSP00000338157	0.971	Zinc finger and BTB domain-containing protein 16
3	9606.ENSP00000357748	0.970	BRCA2 and CDKN1A-interacting protein
4	9606.ENSP00000220592	0.843	Protein argonaute-2
5	9606.ENSP00000375892	0.801	RAC-beta serine/threonine-protein kinase
6	9606.ENSP00000389026	0.761	Cysteine rich secretory protein family
7	9606.ENSP00000359211	0.739	Dihydropyrimidine dehydrogenase [NADP(+)]
8	9606.ENSP00000263253	0.732	Histone acetyltransferase p300
9	9606.ENSP00000315644	0.722	Thymidylate synthase
10	9606.ENSP00000257915	0.682	Alpha-globin transcription factor CP2
11	9606.ENSP00000407586	0.679	GTPase HRas
12	9606.ENSP00000266529	0.664	Zinc finger CCHC-type and RNA binding motif containing 1
13	9606.ENSP00000356621	0.651	Ras GTPase-activating protein nGAP
14	9606.ENSP00000367691	0.640	Lysophosphatidic acid receptor 6
15	9606.ENSP00000263753	0.638	Shugoshin 1
16	9606.ENSP00000344456	0.619	Catenin beta-1
17	9606.ENSP00000220763	0.617	Carboxypeptidase Q
18	9606.ENSP00000451828	0.610	RAC-alpha serine/threonine-protein kinase
19	9606.ENSP00000430338	0.593	Integrator complex subunit 8
20	9606.ENSP00000322396	0.564	Ribosome biogenesis regulatory protein homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.903	heterocyclic compound binding
GO:0097159	0.903	organic cyclic compound binding
GO:0003676	0.874	nucleic acid binding
GO:0003723	0.596	RNA binding
GO:0140110	0.487	transcription regulator activity
GO:0003712	0.427	transcription coregulator activity
GO:0061629	0.425	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003713	0.338	transcription coactivator activity
GO:0003725	0.321	double-stranded RNA binding
GO:0051059	0.319	NF-kappaB binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0048522	0.986	positive regulation of cellular process
GO:0019222	0.971	regulation of metabolic process
GO:0051716	0.969	cellular response to stimulus
GO:0060255	0.922	regulation of macromolecule metabolic process
GO:0048523	0.915	negative regulation of cellular process
GO:0031323	0.911	regulation of cellular metabolic process
GO:0080090	0.899	regulation of primary metabolic process
GO:0009889	0.891	regulation of biosynthetic process
GO:0051171	0.871	regulation of nitrogen compound metabolic process
GO:0007154	0.849	cell communication
GO:0023052	0.842	signaling
GO:0071840	0.825	cellular component organization or biogenesis
GO:0043067	0.813	regulation of programmed cell death
GO:0016043	0.812	cellular component organization
GO:0031326	0.794	regulation of cellular biosynthetic process
GO:0010468	0.793	regulation of gene expression
GO:0050793	0.765	regulation of developmental process
GO:0048583	0.746	regulation of response to stimulus
GO:0009966	0.725	regulation of signal transduction
GO:0051239	0.720	regulation of multicellular organismal process
GO:0043069	0.717	negative regulation of programmed cell death
GO:1902533	0.713	positive regulation of intracellular signal transduction
GO:0042981	0.695	regulation of apoptotic process
GO:0043066	0.689	negative regulation of apoptotic process
GO:0010556	0.688	regulation of macromolecule biosynthetic process
GO:0009893	0.681	positive regulation of metabolic process
GO:2000026	0.680	regulation of multicellular organismal development
GO:0019219	0.677	regulation of nucleobase-containing compound metabolic process
GO:0051094	0.674	positive regulation of developmental process
GO:0051252	0.672	regulation of RNA metabolic process
GO:0051240	0.670	positive regulation of multicellular organismal process
GO:0031325	0.656	positive regulation of cellular metabolic process
GO:0006355	0.649	regulation of DNA-templated transcription
GO:0010605	0.648	negative regulation of macromolecule metabolic process
GO:0042221	0.633	response to chemical
GO:0031324	0.624	negative regulation of cellular metabolic process
GO:0045216	0.623	cell-cell junction organization
GO:0051172	0.620	negative regulation of nitrogen compound metabolic process
GO:0007165	0.611	signal transduction
GO:0043122	0.610	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0045766	0.609	positive regulation of angiogenesis
GO:0043123	0.599	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006357	0.540	regulation of transcription by RNA polymerase II
GO:0065009	0.525	regulation of molecular function
GO:0010558	0.524	negative regulation of macromolecule biosynthetic process
GO:0031327	0.522	negative regulation of cellular biosynthetic process
GO:0044085	0.476	cellular component biogenesis
GO:0051253	0.476	negative regulation of RNA metabolic process
GO:0034329	0.474	cell junction assembly
GO:0009894	0.455	regulation of catabolic process
GO:0070887	0.439	cellular response to chemical stimulus
GO:0044093	0.434	positive regulation of molecular function
GO:0010033	0.426	response to organic substance
GO:0045892	0.425	negative regulation of DNA-templated transcription
GO:0031329	0.420	regulation of cellular catabolic process
GO:0120193	0.419	tight junction organization
GO:0009605	0.408	response to external stimulus
GO:0051090	0.390	regulation of DNA-binding transcription factor activity
GO:0010604	0.388	positive regulation of macromolecule metabolic process
GO:0071310	0.380	cellular response to organic substance
GO:0009896	0.376	positive regulation of catabolic process
GO:0031331	0.368	positive regulation of cellular catabolic process
GO:0007166	0.367	cell surface receptor signaling pathway
GO:1901701	0.356	cellular response to oxygen-containing compound
GO:0032501	0.347	multicellular organismal process
GO:0051091	0.347	positive regulation of DNA-binding transcription factor activity
GO:0032502	0.343	developmental process
GO:0008152	0.342	metabolic process
GO:0071704	0.317	organic substance metabolic process
GO:0051173	0.303	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0031981	1.000	nuclear lumen
GO:0012505	0.999	endomembrane system
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005783	0.991	endoplasmic reticulum
GO:0005654	0.946	nucleoplasm
GO:0005730	0.937	nucleolus
GO:0016020	0.912	membrane
GO:0005829	0.817	cytosol
GO:0032991	0.794	protein-containing complex
GO:0071944	0.378	cell periphery
GO:0005886	0.309	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]