StarFunc result for job id Q86UE8

User Input

>input (772 residues)
MMEELHSLDPRRQELLEARFTGVGVSKGPLNSESSNQSLCSVGSLSDKEVETPEKKQNDQ
RNRKRKAEPYETSQGKGTPRGHKISDYFEFAGGSAPGTSPGRSVPPVARSSPQHSLSNPL
PRRVEQPLYGLDGSAAKEATEEQSALPTLMSVMLAKPRLDTEQLAQRGAGLCFTFVSAQQ
NSPSSTGSGNTEHSCSSQKQISIQHRQTQSDLTIEKISALENSKNSDLEKKEGRIDDLLR
ANCDLRRQIDEQQKMLEKYKERLNRCVTMSKKLLIEKSKQEKMACRDKSMQDRLRLGHFT
TVRHGASFTEQWTDGYAFQNLIKQQERINSQREEIERQRKMLAKRKPPAMGQAPPATNEQ
KQRKSKTNGAENETPSSGNTELKDTAPALGAHSLLRLTLAEYHEQEEIFKLRLGHLKKEE
AEIQAELERLERVRNLHIRELKRIHNEDNSQFKDHPTLNDRYLLLHLLGRGGFSEVYKAF
DLTEQRYVAVKIHQLNKNWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLDTDSF
CTVLEYCEGNDLDFYLKQHKLMSEKEARSIIMQIVNALKYLNEIKPPIIHYDLKPGNILL
VNGTACGEIKITDFGLSKIMDDDSYNSVDGMELTSQGAGTYWYLPPECFVVGKEPPKISN
KVDVWSVGVIFYQCLYGRKPFGHNQSQQDILQENTILKATEVQFPPKPVVTPEAKAFIRR
CLAYRKEDRIDVQQLACDPYLLPHIRKSVSTSSPAGAAIASTSGASNNSSSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86UE8	1.000	1.000	0.000	772	1.000	1.000	Q86UE8.pdb.gz	TLK2_HUMAN Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens OX=9606 GN=TLK2 PE=1 SV=2
2	AFDB:Q39238	0.616	0.687	1.309E-53	688	0.348	0.391	Q39238.pdb.gz	TSL_ARATH Serine/threonine-protein kinase TOUSLED OS=Arabidopsis thaliana OX=3702 GN=TOUSLED PE=1 SV=1
3	AFDB:M9PDQ2	0.397	0.304	1.044E-48	1011	0.367	0.280	M9PDQ2.pdb.gz	M9PDQ2_DROME Tousled-like kinase, isoform L OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
4	PDB:5u6yA	0.309	0.508	1.083E-18	459	0.108	0.181	5u6yA.pdb.gz
5	AFDB:Q8I4W3	0.312	0.327	5.316E-18	735	0.172	0.181	Q8I4W3.pdb.gz	Q8I4W3_PLAF7 RAC-beta serine/threonine protein kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1246900 PE=4 SV=1
6	PDB:7myjC	0.303	0.491	6.491E-18	465	0.098	0.163	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
7	PDB:6b1uA	0.309	0.527	8.064E-18	442	0.098	0.172	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
8	AFDB:X5M5N0	0.317	0.137	1.412E-17	1850	0.166	0.069	X5M5N0.pdb.gz	WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans OX=6239 GN=wnk-1 PE=1 SV=1
9	PDB:4rerA	0.315	0.518	1.724E-17	459	0.098	0.166	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
10	PDB:4zhxA	0.303	0.555	2.261E-17	409	0.098	0.186	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
11	PDB:1unlA	0.289	0.728	4.107E-17	292	0.096	0.253	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
12	AFDB:F4HRJ4	0.319	0.401	4.413E-17	609	0.145	0.184	F4HRJ4.pdb.gz	M3K3A_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana OX=3702 GN=MAPKKK3 PE=1 SV=1
13	AFDB:Q7TPK6	0.307	0.198	4.659E-17	1222	0.118	0.074	Q7TPK6.pdb.gz	WNK4_RAT Serine/threonine-protein kinase WNK4 OS=Rattus norvegicus OX=10116 GN=Wnk4 PE=1 SV=3
14	PDB:5ufuA	0.300	0.603	5.688E-17	369	0.104	0.217	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
15	PDB:7opmA	0.303	0.619	7.067E-17	362	0.102	0.218	7opmA.pdb.gz	A non-catalytic herpesviral protein reconfigures ERK-RSK signaling by targeting kinase docking systems in the host.
16	PDB:2yaaA	0.315	0.770	8.780E-17	300	0.109	0.280	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
17	PDB:4eomC	0.304	0.801	1.152E-16	276	0.093	0.261	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
18	AFDB:P33981	0.305	0.277	1.809E-16	857	0.166	0.149	P33981.pdb.gz	TTK_HUMAN Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK PE=1 SV=2
19	AFDB:A9SY39	0.307	0.312	3.663E-16	759	0.145	0.148	A9SY39.pdb.gz	M3K1A_PHYPA Mitogen-activated protein kinase kinase kinase 1a OS=Physcomitrium patens OX=3218 GN=MEKK1a PE=2 SV=2
20	AFDB:F4IV25	0.309	0.311	4.083E-16	765	0.170	0.171	F4IV25.pdb.gz	F4IV25_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=PAX PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7Z120	0.0	558	1242	0.346	0.215	B7Z120_DROME Tousled-like kinase, isoform I OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
2	B7Z126	0.0	558	1489	0.346	0.179	B7Z126_DROME Tousled-like kinase, isoform G OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
3	G3MTX3	0.0	550	884	0.442	0.386	G3MTX3_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tlk-1 PE=1 SV=1
4	M9PIZ6	0.0	558	1265	0.346	0.211	M9PIZ6_DROME Tousled-like kinase, isoform K OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
5	O55047	0.0	1462	718	0.925	0.994	TLK2_MOUSE Serine/threonine-protein kinase tousled-like 2 OS=Mus musculus OX=10090 GN=Tlk2 PE=1 SV=2
6	P34314	0.0	551	965	0.442	0.353	TLK1_CAEEL Serine/threonine-protein kinase tousled-like 1 OS=Caenorhabditis elegans OX=6239 GN=tlk-1 PE=1 SV=3
7	Q1RL19	0.0	558	1255	0.346	0.213	Q1RL19_DROME LD15160p OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
8	Q2XN10	0.0	550	893	0.440	0.381	Q2XN10_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tlk-1 PE=1 SV=1
9	Q86UE8	0.0	1610	772	1.000	1.000	TLK2_HUMAN Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens OX=9606 GN=TLK2 PE=1 SV=2
10	Q8IRT7	0.0	558	1254	0.346	0.213	Q8IRT7_DROME Tousled-like kinase, isoform C OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=4
11	Q9UKI8	0.0	948	766	0.613	0.617	TLK1_HUMAN Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens OX=9606 GN=TLK1 PE=1 SV=2
12	Q9W4Q4	0.0	558	1266	0.346	0.211	Q9W4Q4_DROME BcDNA.GH07910 OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=2
13	Q8IRT8	3.54e-180	556	1463	0.346	0.183	Q8IRT8_DROME Tousled-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=3
14	M9PDQ2	3.32e-160	493	1011	0.308	0.235	M9PDQ2_DROME Tousled-like kinase, isoform L OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
15	Q39238	2.27e-142	436	688	0.302	0.339	TSL_ARATH Serine/threonine-protein kinase TOUSLED OS=Arabidopsis thaliana OX=3702 GN=TOUSLED PE=1 SV=1
16	Q584I8	1.85e-106	341	647	0.263	0.314	Q584I8_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.710 PE=4 SV=1
17	Q57YS8	8.95e-106	340	650	0.256	0.305	Q57YS8_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.520 PE=4 SV=1
18	Q9VHF6	2.72e-31	131	520	0.113	0.167	Q9VHF6_DROME Serine/threonine-protein kinase ULK3 OS=Drosophila melanogaster OX=7227 GN=Aduk PE=4 SV=1
19	C8V088	7.13e-30	124	391	0.122	0.240	C8V088_EMENI Aurora kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05815 PE=3 SV=1
20	Q683C9	2.04e-28	117	282	0.119	0.326	AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana OX=3702 GN=AUR2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16559 GIT_CC	97	14.1	GIT coiled-coil Rho guanine nucleotide exchange factor
2	PF00069 Pkinase	4.1e-59	211.7	Protein kinase domain
3	PF07714 PK_Tyr_Ser-Thr	1.6e-32	124.4	Protein tyrosine and serine/threonine kinase
4	PF10400 Vir_act_alpha_C	9.2e+02	11.9	Virulence activator alpha C-term

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316512

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263382	0.991	Histone chaperone ASF1B
2	9606.ENSP00000229595	0.987	Histone chaperone ASF1A
3	9606.ENSP00000411099	0.859	Serine/threonine-protein kinase tousled-like 1
4	9606.ENSP00000252512	0.848	Exportin-7
5	9606.ENSP00000307288	0.764	DNA replication licensing factor MCM7
6	9606.ENSP00000161863	0.760	Probable ATP-dependent RNA helicase YTHDC2
7	9606.ENSP00000253363	0.748	RNA-binding protein 39
8	9606.ENSP00000265056	0.748	DNA replication licensing factor MCM2
9	9606.ENSP00000281471	0.723	Protein AMN1 homolog
10	9606.ENSP00000318406	0.694	Dyslexia-associated protein KIAA0319-like protein
11	9606.ENSP00000338039	0.688	Proteasome inhibitor PI31 subunit
12	9606.ENSP00000262127	0.679	Centrosomal protein of 76 kDa
13	9606.ENSP00000386834	0.665	AF4/FMR2 family member 3
14	9606.ENSP00000401802	0.665	26S proteasome regulatory subunit 10B
15	9606.ENSP00000258052	0.649	Sphingomyelin phosphodiesterase 2
16	9606.ENSP00000384863	0.634	Exportin-1
17	9606.ENSP00000431984	0.617	Calpain-1 catalytic subunit
18	9606.ENSP00000381364	0.608	Calcineurin-binding protein cabin-1
19	9606.ENSP00000441953	0.602	Origin recognition complex subunit 4
20	9606.ENSP00000367459	0.600	Dyslexia-associated protein KIAA0319

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0005524	1.000	ATP binding
GO:0042802	0.853	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0050794	0.997	regulation of cellular process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0043170	0.994	macromolecule metabolic process
GO:1901564	0.952	organonitrogen compound metabolic process
GO:0016310	0.949	phosphorylation
GO:0043412	0.945	macromolecule modification
GO:0036211	0.943	protein modification process
GO:0019222	0.856	regulation of metabolic process
GO:0050896	0.848	response to stimulus
GO:0006468	0.820	protein phosphorylation
GO:0060255	0.750	regulation of macromolecule metabolic process
GO:0051171	0.734	regulation of nitrogen compound metabolic process
GO:0080090	0.729	regulation of primary metabolic process
GO:0031323	0.721	regulation of cellular metabolic process
GO:0048519	0.711	negative regulation of biological process
GO:0048523	0.687	negative regulation of cellular process
GO:0051246	0.678	regulation of protein metabolic process
GO:0051716	0.654	cellular response to stimulus
GO:0009892	0.607	negative regulation of metabolic process
GO:0051128	0.588	regulation of cellular component organization
GO:1902275	0.573	regulation of chromatin organization
GO:0007154	0.450	cell communication
GO:0007165	0.438	signal transduction
GO:0018193	0.429	peptidyl-amino acid modification
GO:0035556	0.425	intracellular signal transduction
GO:0048518	0.423	positive regulation of biological process
GO:0031324	0.391	negative regulation of cellular metabolic process
GO:0010605	0.331	negative regulation of macromolecule metabolic process
GO:0048522	0.310	positive regulation of cellular process
GO:0051172	0.301	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0005737	0.978	cytoplasm
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0005856	0.748	cytoskeleton
GO:0032991	0.360	protein-containing complex
GO:0099080	0.301	supramolecular complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.

[back to server]