StarFunc result for job id Q86UK0

User Input

>input (2595 residues)
MASLFHQLQILVWKNWLGVKRQPLWTLVLILWPVIIFIILAITRTKFPPTAKPTCYLAPR
NLPSTGFFPFLQTLLCDTDSKCKDTPYGPQDLLRRKGIDDALFKDSEILRKSSNLDKDSS
LSFQSTQVPERRHASLATVFPSPSSDLEIPGTYTFNGSQVLARILGLEKLLKQNSTSEDI
RRELCDSYSGYIVDDAFSWTFLGRNVFNKFCLSNMTLLESSLQELNKQFSQLSSDPNNQK
IVFQEIVRMLSFFSQVQEQKAVWQLLSSFPNVFQNDTSLSNLFDVLRKANSVLLVVQKVY
PRFATNEGFRTLQKSVKHLLYTLDSPAQGDSDNITHVWNEDDGQTLSPSSLAAQLLILEN
FEDALLNISANSPYIPYLACVRNVTDSLARGSPENLRLLQSTIRFKKSFLRNGSYEDYFP
PVPEVLKSKLSQLRNLTELLCESETFSLIEKSCQLSDMSFGSLCEESEFDLQLLEAAELG
TEIAASLLYHDNVISKKVRDLLTGDPSKINLNMDQFLEQALQMNYLENITQLIPIIEAML
HVNNSADASEKPGQLLEMFKNVEELKEDLRRTTGMSNRTIDKLLAIPIPDNRAEIISQVF
WLHSCDTNITTPKLEDAMKEFCNLSLSERSRQSYLIGLTLLHYLNIYNFTYKVFFPRKDQ
KPVEKMMELFIRLKEILNQMASGTHPLLDKMRSLKQMHLPRSVPLTQAMYRSNRMNTPQG
SFSTISQALCSQGITTEYLTAMLPSSQRPKGNHTKDFLTYKLTKEQIASKYGIPINSTPF
CFSLYKDIINMPAGPVIWAFLKPMLLGRILYAPYNPVTKAIMEKSNVTLRQLAELREKSQ
EWMDKSPLFMNSFHLLNQAIPMLQNTLRNPFVQVFVKFSVGLDAVELLKQIDELDILRLK
LENNIDIIDQLNTLSSLTVNISSCVLYDRIQAAKTIDEMEREAKRLYKSNELFGSVIFKL
PSNRSWHRGYDSGNVFLPPVIKYTIRMSLKTAQTTRSLRTKIWAPGPHNSPSHNQIYGRA
FIYLQDSIERAIIELQTGRNSQEIAVQVQAIPYPCFMKDNFLTSVSYSLPIVLMVAWVVF
IAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLIESVGFLLVTIVILIIILKFGNILP
KTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIAALIGSLIYIIAFFPFIVLVTVENEL
SYVLKVFMSLLSPTAFSYASQYIARYEEQGIGLQWENMYTSPVQDDTTSFGWLCCLILAD
SFIYFLIAWYVRNVFPGTYGMAAPWYFPILPSYWKERFGCAEVKPEKSNGLMFTNIMMQN
TNPSASPEYMFSSNIEPEPKDLTVGVALHGVTKIYGSKVAVDNLNLNFYEGHITSLLGPN
GAGKTTTISMLTGLFGASAGTIFVYGKDIKTDLHTVRKNMGVCMQHDVLFSYLTTKEHLL
LYGSIKVPHWTKKQLHEEVKRTLKDTGLYSHRHKRVGTLSGGMKRKLSISIALIGGSRVV
ILDEPSTGVDPCSRRSIWDVISKNKTARTIILSTHHLDEAEVLSDRIAFLEQGGLRCCGS
PFYLKEAFGDGYHLTLTKKKSPNLNANAVCDTMAVTAMIQSHLPEAYLKEDIGGELVYVL
PPFSTKVSGAYLSLLRALDNGMGDLNIGCYGISDTTVEEVFLNLTKESQKNSAMSLEHLT
QKKIGNSNANGISTPDDLSVSSSNFTDRDDKILTRGERLDGFGLLLKKIMAILIKRFHHT
RRNWKGLIAQVILPIVFVTTAMGLGTLRNSSNSYPEIQISPSLYGTSEQTAFYANYHPST
EALVSAMWDFPGIDNMCLNTSDLQCLNKDSLEKWNTSGEPITNFGVCSCSENVQECPKFN
YSPPHRRTYSSQVIYNLTGQRVENYLISTANEFVQKRYGGWSFGLPLTKDLRFDITGVPA
NRTLAKVWYDPEGYHSLPAYLNSLNNFLLRVNMSKYDAARHGIIMYSHPYPGVQDQEQAT
ISSLIDILVALSILMGYSVTTASFVTYVVREHQTKAKQLQHISGIGVTCYWVTNFIYDMV
FYLVPVAFSIGIIAIFKLPAFYSENNLGAVSLLLLLFGYATFSWMYLLAGLFHETGMAFI
TYVCVNLFFGINSIVSLSVVYFLSKEKPNDPTLELISETLKRIFLIFPQFCFGYGLIELS
QQQSVLDFLKAYGVEYPNETFEMNKLGAMFVALVSQGTMFFSLRLLINESLIKKLRLFFR
KFNSSHVRETIDEDEDVRAERLRVESGAAEFDLVQLYCLTKTYQLIHKKIIAVNNISIGI
PAGECFGLLGVNGAGKTTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQED
ALDDLVTVEEHLYFYARVHGIPEKDIKETVHKLLRRLHLMPFKDRATSMCSYGTKRKLST
ALALIGKPSILLLDEPSSGMDPKSKRHLWKIISEEVQNKCSVILTSHSMEECEALCTRLA
IMVNGKFQCIGSLQHIKSRFGRGFTVKVHLKNNKVTMETLTKFMQLHFPKTYLKDQHLSM
LEYHVPVTAGGVANIFDLLETNKTALNITNFLVSQTTLEEVFINFAKDQKSYETADTSSQ
GSTISVDSQDDQMES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7e7iA	0.540	0.680	0.000	2011	0.248	0.320	7e7iA.pdb.gz
2	PDB:7e7qA	0.548	0.711	0.000	1958	0.252	0.334	7e7qA.pdb.gz	Structural basis of substrate recognition and translocation by human ABCA4.
3	PDB:7lkzA	0.576	0.759	0.000	1920	0.251	0.340	7lkzA.pdb.gz	Molecular structures of the eukaryotic retinal importer ABCA4.
4	PDB:7tbwA	0.580	0.766	0.000	1928	0.259	0.349	7tbwA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
5	PDB:7tbyA	0.510	0.712	0.000	1788	0.241	0.350	7tbyA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
6	AFDB:A0A0G2K1Q8	0.528	0.787	0.000	1704	0.195	0.298	A0A0G2K1Q8.pdb.gz	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
7	AFDB:B8A446	0.616	0.700	0.000	2268	0.274	0.313	B8A446.pdb.gz	B8A446_DANRE ATP-binding cassette sub-family A member 1 OS=Danio rerio OX=7955 GN=abca1 PE=4 SV=1
8	AFDB:E9PWH4	0.522	0.793	0.000	1668	0.184	0.287	E9PWH4.pdb.gz	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
9	AFDB:E9PX95	0.530	0.778	0.000	1733	0.185	0.276	E9PX95.pdb.gz	ABCAH_MOUSE ATP-binding cassette sub-family A member 17 OS=Mus musculus OX=10090 GN=Abca17 PE=1 SV=1
10	AFDB:E9Q876	0.912	0.912	0.000	2595	0.895	0.895	E9Q876.pdb.gz	ABCAC_MOUSE Glucosylceramide transporter ABCA12 OS=Mus musculus OX=10090 GN=Abca12 PE=1 SV=1
11	AFDB:O35600	0.596	0.664	0.000	2310	0.271	0.304	O35600.pdb.gz	ABCA4_MOUSE Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=1 SV=1
12	AFDB:O95477	0.643	0.732	0.000	2261	0.274	0.314	O95477.pdb.gz	ABCA1_HUMAN Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3
13	AFDB:P78363	0.597	0.675	0.000	2273	0.267	0.305	P78363.pdb.gz	ABCA4_HUMAN Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Homo sapiens OX=9606 GN=ABCA4 PE=1 SV=3
14	AFDB:Q7TNJ2	0.636	0.753	0.000	2170	0.282	0.337	Q7TNJ2.pdb.gz	ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1
15	AFDB:Q84M24	0.505	0.684	0.000	1882	0.196	0.270	Q84M24.pdb.gz	AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCA1 PE=2 SV=2
16	PDB:7w01A	0.496	0.779	6.560E-102	1598	0.194	0.315	7w01A.pdb.gz
17	PDB:7w02A	0.485	0.772	1.130E-101	1566	0.195	0.324	7w02A.pdb.gz	Cryo-EM structures of the human surfactant lipid transporter ABCA3.
18	PDB:7m1pA	0.516	0.673	1.600E-98	1938	0.232	0.311	7m1pA.pdb.gz
19	PDB:7roqA	0.480	0.656	5.256E-97	1831	0.224	0.317	7roqA.pdb.gz	Structure of the Human Lipid Exporter ABCA1.
20	PDB:7m1qA	0.496	0.654	1.649E-95	1911	0.225	0.306	7m1qA.pdb.gz	Cryo-EM structures of the ABCA4 importer reveal mechanisms underlying substrate binding and Stargardt disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A087WXK5	1043	2466	0.253	0.266	A0A087WXK5_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens OX=9606 GN=ABCA2 PE=1 SV=1
2	A0A8I5ZLK5	1199	2263	0.270	0.310	A0A8I5ZLK5_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=1
3	A0A8I6ATT1	1209	2190	0.270	0.320	A0A8I6ATT1_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=1
4	B2RY11	4834	2595	0.895	0.895	B2RY11_MOUSE Abca12 protein OS=Mus musculus OX=10090 GN=Abca12 PE=2 SV=1
5	B2RY21	4838	2595	0.896	0.896	B2RY21_MOUSE Abca12 protein OS=Mus musculus OX=10090 GN=Abca12 PE=2 SV=1
6	B8A446	1178	2268	0.276	0.316	B8A446_DANRE ATP-binding cassette sub-family A member 1 OS=Danio rerio OX=7955 GN=abca1 PE=4 SV=1
7	E9Q876	4834	2595	0.896	0.896	ABCAC_MOUSE Glucosylceramide transporter ABCA12 OS=Mus musculus OX=10090 GN=Abca12 PE=1 SV=1
8	F1LNL3	1201	2201	0.270	0.318	F1LNL3_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=4
9	F1MWM0	1159	2281	0.267	0.303	ABCA4_BOVIN Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Bos taurus OX=9913 GN=ABCA4 PE=1 SV=2
10	K9J4V5	1199	2262	0.266	0.305	K9J4V5_PIG ATP-binding cassette sub-family A member 1 OS=Sus scrofa OX=9823 GN=ABCA1 PE=2 SV=1
11	O35600	1165	2310	0.265	0.298	ABCA4_MOUSE Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Mus musculus OX=10090 GN=Abca4 PE=1 SV=1
12	O95477	1192	2261	0.266	0.305	ABCA1_HUMAN Phospholipid-transporting ATPase ABCA1 OS=Homo sapiens OX=9606 GN=ABCA1 PE=1 SV=3
13	P41233	1196	2261	0.267	0.307	ABCA1_MOUSE Phospholipid-transporting ATPase ABCA1 OS=Mus musculus OX=10090 GN=Abca1 PE=1 SV=4
14	P41234	997	2434	0.246	0.262	ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus OX=10090 GN=Abca2 PE=1 SV=4
15	P78363	1117	2273	0.263	0.300	ABCA4_HUMAN Retinal-specific phospholipid-transporting ATPase ABCA4 OS=Homo sapiens OX=9606 GN=ABCA4 PE=1 SV=3
16	Q5SSE9	1420	5034	0.315	0.162	ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus OX=10090 GN=Abca13 PE=1 SV=1
17	Q7TNJ2	1057	2170	0.267	0.319	ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus OX=10116 GN=Abca7 PE=1 SV=1
18	Q80ZB2	1189	2201	0.269	0.317	Q80ZB2_RAT ATP-binding cassette 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=2 SV=1
19	Q86UK0	5382	2595	1.000	1.000	ABCAC_HUMAN Glucosylceramide transporter ABCA12 OS=Homo sapiens OX=9606 GN=ABCA12 PE=1 SV=3
20	Q86UQ4	1455	5058	0.323	0.166	ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens OX=9606 GN=ABCA13 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.5e+02	14.1	AAA ATPase domain
2	PF13304 AAA_21	2.6e-19	81.7	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13476 AAA_23	11	18.0	AAA domain
4	PF13555 AAA_29	1.1e+02	13.9	P-loop containing region of AAA domain
5	PF13604 AAA_30	8.6	17.5	AAA domain
6	PF12698 ABC2_membrane_3	3.7e-50	182.6	ABC-2 family transporter protein
7	PF00005 ABC_tran	4.6e-52	187.6	ABC transporter
8	PF13732 DUF4162	5.7e+02	12.7	Domain of unknown function (DUF4162)
9	PF04310 MukB	1e+02	14.0	MukB N-terminal
10	PF13558 SbcC_Walker_B	4.8e+02	12.4	SbcC/RAD50-like, Walker B motif
11	PF02463 SMC_N	5.4	17.9	RecF/RecN/SMC N terminal domain
12	PF00448 SRP54	2.4e+02	12.7	SRP54-type protein, GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272895

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000311687	0.858	Magnesium transporter NIPA4
2	9606.ENSP00000269703	0.839	Cytochrome P450 family 4 subfamily F member 22
3	9606.ENSP00000206765	0.832	Protein-glutamine gamma-glutamyltransferase K
4	9606.ENSP00000314879	0.814	Hydroperoxide isomerase ALOXE3
5	9606.ENSP00000311313	0.812	Cystatin-M
6	9606.ENSP00000315167	0.765	Arachidonate 12-lipoxygenase, 12R-type
7	9606.ENSP00000378072	0.747	Patatin-like phospholipase domain-containing protein 1
8	9606.ENSP00000383923	0.710	Lipase member N
9	9606.ENSP00000284382	0.693	Ceramide synthase 3
10	9606.ENSP00000296468	0.594	Major facilitator superfamily domain-containing protein 8
11	9606.ENSP00000296577	0.576	ATP-binding cassette sub-family E member 1
12	9606.ENSP00000376896	0.568	Interleukin-36 receptor antagonist protein
13	9606.ENSP00000363689	0.554	DNA-binding protein inhibitor ID-3
14	9606.ENSP00000365280	0.548	DNA-binding protein inhibitor ID-1
15	9606.ENSP00000390849	0.546	1-acylglycerol-3-phosphate O-acyltransferase ABHD5
16	9606.ENSP00000352936	0.534	Serine protease inhibitor Kazal-type 5
17	9606.ENSP00000382670	0.534	Glutaredoxin domain-containing cysteine-rich protein 1
18	9606.ENSP00000357753	0.525	Involucrin
19	9606.ENSP00000357731	0.521	Loricrin
20	9606.ENSP00000357789	0.519	Filaggrin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	0.998	ATP-dependent activity
GO:0005515	0.998	protein binding
GO:0022857	0.996	transmembrane transporter activity
GO:0042626	0.992	ATPase-coupled transmembrane transporter activity
GO:0005319	0.982	lipid transporter activity
GO:0097159	0.599	organic cyclic compound binding
GO:1901363	0.542	heterocyclic compound binding
GO:0043167	0.488	ion binding
GO:0034190	0.432	apolipoprotein receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032376	0.986	positive regulation of cholesterol transport
GO:0009987	0.946	cellular process
GO:0008152	0.861	metabolic process
GO:0051179	0.826	localization
GO:0071704	0.763	organic substance metabolic process
GO:0044238	0.737	primary metabolic process
GO:0006810	0.729	transport
GO:0071702	0.668	organic substance transport
GO:0050794	0.642	regulation of cellular process
GO:0044237	0.589	cellular metabolic process
GO:0006629	0.525	lipid metabolic process
GO:0006807	0.495	nitrogen compound metabolic process
GO:1901564	0.479	organonitrogen compound metabolic process
GO:0032502	0.392	developmental process
GO:0048856	0.366	anatomical structure development
GO:0033036	0.326	macromolecule localization
GO:0010874	0.319	regulation of cholesterol efflux

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0031090	0.999	organelle membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0005886	0.951	plasma membrane
GO:0031410	0.943	cytoplasmic vesicle
GO:0098588	0.898	bounding membrane of organelle
GO:0005829	0.782	cytosol
GO:0099503	0.636	secretory vesicle
GO:0030659	0.621	cytoplasmic vesicle membrane
GO:0030141	0.504	secretory granule
GO:0042599	0.402	lamellar body
GO:0005794	0.393	Golgi apparatus
GO:0030667	0.363	secretory granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.992	Translocases.

[back to server]