StarFunc result for job id Q86UL3

User Input

>input (456 residues)
MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAIFGVSFGIRKLYMKSLLKIFAWATLR
MERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCR
KGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCFLLPLRI
ALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMCYRICVRALTAIITYHDRENRPRN
GGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHL
VAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAF
WNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDLL
WDGGLKREKVKDTFKEEQQKLYSKMIVGNHKDRSRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86UL3	1.000	1.000	4.553E-83	456	1.000	1.000	Q86UL3.pdb.gz	GPAT4_HUMAN Glycerol-3-phosphate acyltransferase 4 OS=Homo sapiens OX=9606 GN=GPAT4 PE=1 SV=1
2	AFDB:Q8C0N2	0.864	0.898	1.049E-58	438	0.649	0.676	Q8C0N2.pdb.gz	GPAT3_MOUSE Glycerol-3-phosphate acyltransferase 3 OS=Mus musculus OX=10090 GN=Gpat3 PE=1 SV=1
3	AFDB:Q960R0	0.838	0.835	7.304E-49	458	0.480	0.478	Q960R0.pdb.gz	Q960R0_DROME Glycerol-3-phosphate acyltransferase 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
4	AFDB:Q9W1B5	0.860	0.854	2.788E-48	459	0.461	0.458	Q9W1B5.pdb.gz	Q9W1B5_DROME Glycerol-3-phosphate acyltransferase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=2
5	AFDB:Q21812	0.857	0.766	4.516E-48	512	0.445	0.396	Q21812.pdb.gz	Q21812_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-5 PE=1 SV=1
6	AFDB:Q9N5S8	0.813	0.606	2.027E-46	617	0.474	0.350	Q9N5S8.pdb.gz	Q9N5S8_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=1
7	AFDB:A0A0B4LGJ9	0.536	0.457	2.802E-44	537	0.478	0.406	A0A0B4LGJ9.pdb.gz	A0A0B4LGJ9_DROME Glycerol-3-phosphate acyltransferase 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
8	AFDB:Q8GWG0	0.654	0.784	3.527E-32	376	0.285	0.346	Q8GWG0.pdb.gz	GPAT9_ARATH Glycerol-3-phosphate acyltransferase 9 OS=Arabidopsis thaliana OX=3702 GN=GPAT9 PE=1 SV=1
9	AFDB:Q554U0	0.648	0.608	4.375E-31	488	0.305	0.285	Q554U0.pdb.gz	Q554U0_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274969 PE=3 SV=1
10	AFDB:G5EE59	0.702	0.724	5.741E-28	441	0.232	0.240	G5EE59.pdb.gz	G5EE59_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M79.2 PE=1 SV=1
11	PDB:5f2tB	0.235	0.361	6.086E-4	262	0.070	0.122	5f2tB.pdb.gz	Structural basis for selective recognition of acyl chains by the membrane-associated acyltransferase PatA.
12	PDB:7f73A	0.138	0.194	5.791E-1	293	0.072	0.113	7f73A.pdb.gz
13	PDB:3jz4A	0.126	0.121	6.109E-1	481	0.044	0.042	3jz4A.pdb.gz	The X-ray crystal structure of Escherichia coli succinic semialdehyde dehydrogenase; structural insights into NADP+/enzyme interactions.
14	PDB:7ena6	0.100	0.079	6.109E-1	652	0.066	0.046	7ena6.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
15	PDB:2gamC	0.145	0.168	6.800E-1	374	0.050	0.061	2gamC.pdb.gz	X-ray Crystal Structure of Leukocyte Type Core 2 beta1,6-N-Acetylglucosaminyltransferase: Evidence for a covergence of metal ion independent glycosyltransferase mechanism.
16	PDB:6umrA	0.185	0.197	6.800E-1	418	0.103	0.112	6umrA.pdb.gz
17	PDB:3ecsC	0.108	0.146	7.175E-1	294	0.064	0.099	3ecsC.pdb.gz	Crystal structure of the alpha subunit of human translation initiation factor 2B
18	PDB:7quyA	0.131	0.164	7.986E-1	352	0.024	0.031	7quyA.pdb.gz	Advanced Insights into Catalytic and Structural Features of the Zinc-Dependent Alcohol Dehydrogenase from Thauera aromatica.
19	PDB:1ky8A	0.125	0.117	9.379E-1	499	0.057	0.052	1ky8A.pdb.gz	The Crystal Structure of the Allosteric Non-phosphorylating glyceraldehyde-3-phosphate Dehydrogenase from the Hyperthermophilic Archaeum Thermoproteus tenax
20	PDB:7bkpA	0.130	0.096	1.101	689	0.088	0.058	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q53EU6	0.0	634	434	0.660	0.694	GPAT3_HUMAN Glycerol-3-phosphate acyltransferase 3 OS=Homo sapiens OX=9606 GN=GPAT3 PE=1 SV=2
2	Q86UL3	0.0	947	456	1.000	1.000	GPAT4_HUMAN Glycerol-3-phosphate acyltransferase 4 OS=Homo sapiens OX=9606 GN=GPAT4 PE=1 SV=1
3	Q8C0N2	0.0	631	438	0.651	0.678	GPAT3_MOUSE Glycerol-3-phosphate acyltransferase 3 OS=Mus musculus OX=10090 GN=Gpat3 PE=1 SV=1
4	Q8K2C8	0.0	931	456	0.976	0.976	GPAT4_MOUSE Glycerol-3-phosphate acyltransferase 4 OS=Mus musculus OX=10090 GN=Gpat4 PE=1 SV=1
5	Q960R0	2.31e-157	455	458	0.485	0.483	Q960R0_DROME Glycerol-3-phosphate acyltransferase 4, isoform B OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
6	Q9W1B5	1.25e-147	430	459	0.452	0.449	Q9W1B5_DROME Glycerol-3-phosphate acyltransferase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=2
7	Q21812	1.15e-143	422	512	0.447	0.398	Q21812_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-5 PE=1 SV=1
8	Q9N5S9	3.79e-141	412	410	0.408	0.454	Q9N5S9_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=2
9	Q9N5S8	1.13e-140	418	617	0.414	0.306	Q9N5S8_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-4 PE=1 SV=1
10	Q1ZXU8	1.86e-140	412	455	0.412	0.413	Q1ZXU8_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acl-5 PE=1 SV=1
11	A0A0B4LGJ9	1.12e-117	357	537	0.357	0.304	A0A0B4LGJ9_DROME Glycerol-3-phosphate acyltransferase 4, isoform D OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
12	A0A0B4LHH1	5.26e-89	278	380	0.268	0.321	A0A0B4LHH1_DROME Glycerol-3-phosphate acyltransferase 4, isoform E OS=Drosophila melanogaster OX=7227 GN=Gpat4 PE=1 SV=1
13	Q554U0	3.52e-84	269	488	0.318	0.297	Q554U0_DICDI Phospholipid/glycerol acyltransferase domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274969 PE=3 SV=1
14	Q8GWG0	2.99e-75	242	376	0.305	0.370	GPAT9_ARATH Glycerol-3-phosphate acyltransferase 9 OS=Arabidopsis thaliana OX=3702 GN=GPAT9 PE=1 SV=1
15	G5EE59	6.44e-44	161	441	0.193	0.200	G5EE59_CAEEL Phospholipid/glycerol acyltransferase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_M79.2 PE=1 SV=1
16	Q0KHU5	4.85e-16	82.8	533	0.110	0.094	PCAT_DROME Lysophosphatidylcholine acyltransferase OS=Drosophila melanogaster OX=7227 GN=LPCAT PE=2 SV=1
17	Q8L7R3	2.22e-11	67.8	398	0.116	0.133	LPCT1_ARATH Lysophospholipid acyltransferase LPEAT1 OS=Arabidopsis thaliana OX=3702 GN=LPEAT1 PE=1 SV=1
18	Q7L5N7	1.77e-10	65.5	544	0.099	0.083	PCAT2_HUMAN Lysophosphatidylcholine acyltransferase 2 OS=Homo sapiens OX=9606 GN=LPCAT2 PE=1 SV=1
19	Q8BYI6	2.98e-09	61.6	544	0.090	0.075	PCAT2_MOUSE Lysophosphatidylcholine acyltransferase 2 OS=Mus musculus OX=10090 GN=Lpcat2 PE=1 SV=1
20	Q8NF37	3.79e-09	61.2	534	0.081	0.069	PCAT1_HUMAN Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01553 Acyltransferase	9e-16	69.2	Acyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380184

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381140	0.982	1-acyl-sn-glycerol-3-phosphate acyltransferase gamma
2	9606.ENSP00000302177	0.980	Lysophospholipid acyltransferase 2
3	9606.ENSP00000378877	0.976	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha
4	9606.ENSP00000360761	0.975	1-acyl-sn-glycerol-3-phosphate acyltransferase beta
5	9606.ENSP00000285518	0.973	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
6	9606.ENSP00000314036	0.973	1-acyl-sn-glycerol-3-phosphate acyltransferase delta
7	9606.ENSP00000265276	0.971	Glycerol-3-phosphate acyltransferase 1, mitochondrial
8	9606.ENSP00000389395	0.959	Glycerol-3-phosphate acyltransferase 2, mitochondrial
9	9606.ENSP00000310551	0.958	Lysocardiolipin acyltransferase 1
10	9606.ENSP00000390849	0.958	1-acylglycerol-3-phosphate O-acyltransferase ABHD5
11	9606.ENSP00000324944	0.948	Lysophospholipid acyltransferase 1
12	9606.ENSP00000317300	0.941	Lysophospholipid acyltransferase LPCAT4
13	9606.ENSP00000261407	0.939	Lysophospholipid acyltransferase 5
14	9606.ENSP00000245615	0.933	Lysophospholipid acyltransferase 7
15	9606.ENSP00000282541	0.916	Glycerol-3-phosphate dehydrogenase 1-like protein
16	9606.ENSP00000301149	0.916	Glycerol-3-phosphate dehydrogenase 1
17	9606.ENSP00000401720	0.913	Glycerol kinase
18	9606.ENSP00000351706	0.912	Glycerol kinase 2
19	9606.ENSP00000308610	0.909	Glycerol-3-phosphate dehydrogenase, mitochondrial
20	9606.ENSP00000347581	0.906	Acylglycerol kinase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004366	1.000	glycerol-3-phosphate O-acyltransferase activity
GO:0003841	0.998	1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0005515	0.906	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0006629	0.995	lipid metabolic process
GO:0044255	0.987	cellular lipid metabolic process
GO:1901576	0.986	organic substance biosynthetic process
GO:0045017	0.982	glycerolipid biosynthetic process
GO:0006796	0.919	phosphate-containing compound metabolic process
GO:0019637	0.896	organophosphate metabolic process
GO:0090407	0.843	organophosphate biosynthetic process
GO:0006644	0.825	phospholipid metabolic process
GO:0008654	0.687	phospholipid biosynthetic process
GO:0044281	0.673	small molecule metabolic process
GO:0006650	0.540	glycerophospholipid metabolic process
GO:0006639	0.377	acylglycerol metabolic process
GO:0006807	0.361	nitrogen compound metabolic process
GO:0046474	0.361	glycerophospholipid biosynthetic process
GO:0046463	0.358	acylglycerol biosynthetic process
GO:0019432	0.352	triglyceride biosynthetic process
GO:0065007	0.323	biological regulation
GO:1901564	0.315	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0016020	0.979	membrane
GO:0031090	0.911	organelle membrane
GO:0098827	0.848	endoplasmic reticulum subcompartment
GO:0005789	0.826	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15325	1.000	an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.15	1.000	glycerol-3-phosphate 1-O-acyltransferase.
RHEA:19709	0.998	a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA
EC:2.3.1.51	0.998	1-acylglycerol-3-phosphate O-acyltransferase.

[back to server]