StarFunc result for job id Q86UL8

User Input

>input (1455 residues)
MSKSLKKKSHWTSKVHESVIGRNPEGQLGFELKGGAENGQFPYLGEVKPGKVAYESGSKL
VSEELLLEVNETPVAGLTIRDVLAVIKHCKDPLRLKCVKQGGIVDKDLRHYLNLRFQKGS
VDHELQQIIRDNLYLRTVPCTTRPHKEGEVPGVDYIFITVEDFMELEKSGALLESGTYED
NYYGTPKPPAEPAPLLLNVTDQILPGATPSAEGKRKRNKSVSNMEKASIEPPEEEEEERP
VVNGNGVVVTPESSEHEDKSAGASGEMPSQPYPAPVYSQPEELKEQMDDTKPTKPEDNEE
PDPLPDNWEMAYTEKGEVYFIDHNTKTTSWLDPRLAKKAKPPEECKENELPYGWEKIDDP
IYGTYYVDHINRRTQFENPVLEAKRKLQQHNMPHTELGTKPLQAPGFREKPLFTRDASQL
KGTFLSTTLKKSNMGFGFTIIGGDEPDEFLQVKSVIPDGPAAQDGKMETGDVIVYINEVC
VLGHTHADVVKLFQSVPIGQSVNLVLCRGYPLPFDPEDPANSMVPPLAIMERPPPVMVNG
RHNYETYLEYISRTSQSVPDITDRPPHSLHSMPTDGQLDGTYPPPVHDDNVSMASSGATQ
AELMTLTIVKGAQGFGFTIADSPTGQRVKQILDIQGCPGLCEGDLIVEINQQNVQNLSHT
EVVDILKDCPIGSETSLIIHRGGFFSPWKTPKPIMDRWENQGSPQTSLSAPAIPQNLPFP
PALHRSSFPDSTEAFDPRKPDPYELYEKSRAIYESRQQVPPRTSFRMDSSGPDYKELDVH
LRRMESGFGFRILGGDEPGQPILIGAVIAMGSADRDGRLHPGDELVYVDGIPVAGKTHRY
VIDLMHHAARNGQVNLTVRRKVLCGGEPCPENGRSPGSVSTHHSSPRSDYATYTNSNHAA
PSSNASPPEGFASHSLQTSDVVIHRKENEGFGFVIISSLNRPESGSTITVPHKIGRIIDG
SPADRCAKLKVGDRILAVNGQSIINMPHADIVKLIKDAGLSVTLRIIPQEELNSPTSAPS
SEKQSPMAQQSPLAQQSPLAQPSPATPNSPIAQPAPPQPLQLQGHENSYRSEVKARQDVK
PDIRQPPFTDYRQPPLDYRQPPGGDYQQPPPLDYRQPPLLDYRQHSPDTRQYPLSDYRQP
QDFDYFTVDMEKGAKGFGFSIRGGREYKMDLYVLRLAEDGPAIRNGRMRVGDQIIEINGE
STRDMTHARAIELIKSGGRRVRLLLKRGTGQVPEYDEPAPWSSPAAAAPGLPEVGVSLDD
GLAPFSPSHPAPPSDPSHQISPGPTWDIKREHDVRKPKELSACGQKKQRLGEQRERSASP
QRAARPRLEEAPGGQGRPEAGRPASEARAPGLAAADAADAARAGGKEAPRAAAGSELCRR
EGPGAAPAFAGPGGGGSGALEAEGRAGARAGPRPGPRPPGGAPARKAAVAPGPWKVPGSD
KLPSVLKPGASAASR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Q8D8	0.170	0.215	0.000	1081	0.539	0.725	A0A2R8Q8D8.pdb.gz
2	AFDB:A0A2R8QJF4	0.155	0.192	0.000	1093	0.534	0.711	A0A2R8QJF4.pdb.gz
3	AFDB:F1NMZ1	0.162	0.181	0.000	1256	0.430	0.498	F1NMZ1.pdb.gz
4	AFDB:F1Q897	0.254	0.247	0.000	1503	0.665	0.644	F1Q897.pdb.gz	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
5	AFDB:Q5F488	0.228	0.284	0.000	1128	0.421	0.543	Q5F488.pdb.gz	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
6	AFDB:Q5TCQ9	0.288	0.284	0.000	1481	0.452	0.444	Q5TCQ9.pdb.gz	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
7	AFDB:Q6RHR9	0.196	0.194	0.000	1471	0.452	0.447	Q6RHR9.pdb.gz	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
8	AFDB:Q86UL8	0.999	0.999	0.000	1455	1.000	1.000	Q86UL8.pdb.gz	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
9	AFDB:Q96QZ7	0.175	0.173	0.000	1491	0.466	0.455	Q96QZ7.pdb.gz	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
10	AFDB:Q9EQJ9	0.270	0.267	0.000	1476	0.447	0.440	Q9EQJ9.pdb.gz	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
11	PDB:2xkxA	0.061	0.115	4.281E-15	721	0.063	0.126	2xkxA.pdb.gz
12	PDB:5n7dA	0.072	0.246	6.416E-14	423	0.052	0.177	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
13	PDB:7p73A	0.060	0.202	6.883E-7	420	0.021	0.074	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:6t36A	0.059	0.858	2.665E-6	93	0.014	0.226	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
15	PDB:7pc3A	0.058	0.202	2.813E-6	405	0.018	0.064	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:7p70A	0.057	0.200	4.338E-6	407	0.019	0.069	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
17	PDB:7qqmA	0.056	0.192	6.689E-6	413	0.022	0.077	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
18	PDB:6pcvA	0.061	0.106	9.772E-6	754	0.028	0.054	6pcvA.pdb.gz
19	PDB:7qqnC	0.053	0.184	1.871E-5	414	0.016	0.056	7qqnC.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
20	PDB:7pcbA	0.054	0.180	2.589E-5	415	0.021	0.072	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WT53	0.0	702	1155	0.276	0.347	A0A087WT53_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
2	A0A087WXD2	0.0	698	980	0.278	0.412	A0A087WXD2_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
3	A0A8I3NPD4	0.0	872	1398	0.343	0.357	A0A8I3NPD4_CANLF Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Canis lupus familiaris OX=9615 GN=MAGI1 PE=1 SV=1
4	F1Q897	0.0	1793	1503	0.674	0.653	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
5	H7C4U7	0.0	803	1131	0.326	0.420	H7C4U7_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
6	H7C535	0.0	803	1136	0.326	0.418	H7C535_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
7	H7C5T8	0.0	728	1014	0.297	0.426	H7C5T8_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
8	O88382	0.0	2471	1277	0.826	0.941	MAGI2_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Magi2 PE=1 SV=1
9	Q5F488	0.0	1051	1128	0.427	0.551	MAGI3_CHICK Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Gallus gallus OX=9031 GN=MAGI3 PE=2 SV=1
10	Q5TCQ9	0.0	1074	1481	0.423	0.415	MAGI3_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAGI3 PE=1 SV=3
11	Q6RHR9	0.0	936	1471	0.375	0.370	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
12	Q86UL8	0.0	2974	1455	1.000	1.000	MAGI2_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MAGI2 PE=1 SV=3
13	Q96QZ7	0.0	952	1491	0.380	0.371	MAGI1_HUMAN Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=3
14	Q9EQJ9	0.0	1050	1476	0.432	0.425	MAGI3_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Mus musculus OX=10090 GN=Magi3 PE=1 SV=2
15	Q9JK71	0.0	1052	1470	0.431	0.427	MAGI3_RAT Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Magi3 PE=1 SV=2
16	Q9WVQ1	0.0	2484	1275	0.831	0.948	MAGI2_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Mus musculus OX=10090 GN=Magi2 PE=1 SV=2
17	Q9W2L2	8.31e-88	315	1202	0.122	0.147	Q9W2L2_DROME LD27118p OS=Drosophila melanogaster OX=7227 GN=Magi PE=1 SV=2
18	D3YT29	2.13e-82	291	829	0.150	0.263	D3YT29_CAEEL PDZ domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
19	C6KRJ8	2.93e-82	290	802	0.150	0.272	C6KRJ8_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1
20	C1P634	8.53e-82	290	855	0.150	0.255	C1P634_CAEEL Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2 OS=Caenorhabditis elegans OX=6239 GN=magi-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19805 DUF6288	0.14	22.9	Family of unknown function (DUF6288)
2	PF00625 Guanylate_kin	1.4e-06	39.6	Guanylate kinase
3	PF16663 MAGI_u1	1.2e-22	90.9	Unstructured region on MAGI
4	PF16666 MAGI_u5	1	21.3	Unstructured region on MAGI
5	PF00595 PDZ	6e-65	226.9	PDZ domain
6	PF13180 PDZ_2	1.9e-22	90.7	PDZ domain
7	PF17820 PDZ_6	4.8e-42	153.0	PDZ domain
8	PF02163 Peptidase_M50	7.5e-10	50.2	Peptidase family M50
9	PF14685 Tricorn_PDZ	0.044	25.1	Tricorn protease PDZ domain
10	PF00397 WW	6.6e-13	59.8	WW domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346151

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344456	0.998	Catenin beta-1
2	9606.ENSP00000361021	0.998	Phosphatase and tensin homolog
3	9606.ENSP00000390590	0.977	Dendrin
4	9606.ENSP00000368190	0.960	Nephrin
5	9606.ENSP00000293662	0.940	General receptor for phosphoinositides 1-associated scaffold protein
6	9606.ENSP00000264431	0.924	Rap guanine nucleotide exchange factor 2
7	9606.ENSP00000300105	0.894	Voltage-dependent calcium channel gamma-2 subunit
8	9606.ENSP00000442600	0.865	Dystroglycan
9	9606.ENSP00000355718	0.837	Delta-like protein 1
10	9606.ENSP00000385450	0.832	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
11	9606.ENSP00000358301	0.825	Beta-1 adrenergic receptor
12	9606.ENSP00000304604	0.820	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3
13	9606.ENSP00000296859	0.805	Rap guanine nucleotide exchange factor 6
14	9606.ENSP00000305288	0.789	Neuroligin-2
15	9606.ENSP00000251472	0.756	Microtubule-associated serine/threonine-protein kinase 1
16	9606.ENSP00000354671	0.740	Microtubule-associated serine/threonine-protein kinase 2
17	9606.ENSP00000307134	0.738	Catenin delta-2
18	9606.ENSP00000436552	0.720	Protein turtle homolog B
19	9606.ENSP00000392500	0.711	Neuroligin-1
20	9606.ENSP00000262320	0.682	Axin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.981	signaling receptor binding
GO:0019899	0.971	enzyme binding
GO:0001664	0.912	G protein-coupled receptor binding
GO:0019902	0.796	phosphatase binding
GO:0031690	0.770	adrenergic receptor binding
GO:0035591	0.731	signaling adaptor activity
GO:0030159	0.720	signaling receptor complex adaptor activity
GO:0031697	0.527	beta-1 adrenergic receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.967	cellular process
GO:0048518	0.949	positive regulation of biological process
GO:0048519	0.877	negative regulation of biological process
GO:0048523	0.865	negative regulation of cellular process
GO:0050896	0.854	response to stimulus
GO:0032501	0.775	multicellular organismal process
GO:0023051	0.770	regulation of signaling
GO:0010646	0.769	regulation of cell communication
GO:0048583	0.750	regulation of response to stimulus
GO:0032502	0.743	developmental process
GO:0048522	0.667	positive regulation of cellular process
GO:0032879	0.663	regulation of localization
GO:0051716	0.650	cellular response to stimulus
GO:0048856	0.626	anatomical structure development
GO:0071840	0.617	cellular component organization or biogenesis
GO:0007275	0.574	multicellular organism development
GO:0007154	0.570	cell communication
GO:0023052	0.569	signaling
GO:0009966	0.557	regulation of signal transduction
GO:0007165	0.545	signal transduction
GO:0048731	0.536	system development
GO:0065009	0.496	regulation of molecular function
GO:0016043	0.495	cellular component organization
GO:0060255	0.453	regulation of macromolecule metabolic process
GO:0032835	0.422	glomerulus development
GO:0044093	0.389	positive regulation of molecular function
GO:0051128	0.353	regulation of cellular component organization
GO:0051171	0.326	regulation of nitrogen compound metabolic process
GO:0009893	0.326	positive regulation of metabolic process
GO:0010604	0.322	positive regulation of macromolecule metabolic process
GO:0080090	0.320	regulation of primary metabolic process
GO:0031323	0.320	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0030054	0.999	cell junction
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.999	intracellular organelle
GO:0005737	0.996	cytoplasm
GO:0005634	0.978	nucleus
GO:0005829	0.917	cytosol
GO:0070161	0.915	anchoring junction
GO:0043232	0.760	intracellular non-membrane-bounded organelle
GO:0005911	0.751	cell-cell junction
GO:0070013	0.506	intracellular organelle lumen
GO:0031981	0.439	nuclear lumen
GO:0012505	0.375	endomembrane system
GO:0032991	0.330	protein-containing complex
GO:0070160	0.324	tight junction
GO:0005654	0.319	nucleoplasm
GO:0042995	0.315	cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]